<!DOCTYPE html PUBLIC "-//W3C//DTD XHTML 1.1//EN"
"http://www.w3.org/TR/xhtml11/DTD/xhtml11.dtd">
<html xmlns="http://www.w3.org/1999/xhtml">
<head><meta http-equiv="content-type" content="text/html; charset=utf-8" />
<title>[127178] trunk/dports/aqua/emacs-app</title>
</head>
<body>
<style type="text/css"><!--
#msg dl.meta { border: 1px #006 solid; background: #369; padding: 6px; color: #fff; }
#msg dl.meta dt { float: left; width: 6em; font-weight: bold; }
#msg dt:after { content:':';}
#msg dl, #msg dt, #msg ul, #msg li, #header, #footer, #logmsg { font-family: verdana,arial,helvetica,sans-serif; font-size: 10pt; }
#msg dl a { font-weight: bold}
#msg dl a:link { color:#fc3; }
#msg dl a:active { color:#ff0; }
#msg dl a:visited { color:#cc6; }
h3 { font-family: verdana,arial,helvetica,sans-serif; font-size: 10pt; font-weight: bold; }
#msg pre { overflow: auto; background: #ffc; border: 1px #fa0 solid; padding: 6px; }
#logmsg { background: #ffc; border: 1px #fa0 solid; padding: 1em 1em 0 1em; }
#logmsg p, #logmsg pre, #logmsg blockquote { margin: 0 0 1em 0; }
#logmsg p, #logmsg li, #logmsg dt, #logmsg dd { line-height: 14pt; }
#logmsg h1, #logmsg h2, #logmsg h3, #logmsg h4, #logmsg h5, #logmsg h6 { margin: .5em 0; }
#logmsg h1:first-child, #logmsg h2:first-child, #logmsg h3:first-child, #logmsg h4:first-child, #logmsg h5:first-child, #logmsg h6:first-child { margin-top: 0; }
#logmsg ul, #logmsg ol { padding: 0; list-style-position: inside; margin: 0 0 0 1em; }
#logmsg ul { text-indent: -1em; padding-left: 1em; }#logmsg ol { text-indent: -1.5em; padding-left: 1.5em; }
#logmsg > ul, #logmsg > ol { margin: 0 0 1em 0; }
#logmsg pre { background: #eee; padding: 1em; }
#logmsg blockquote { border: 1px solid #fa0; border-left-width: 10px; padding: 1em 1em 0 1em; background: white;}
#logmsg dl { margin: 0; }
#logmsg dt { font-weight: bold; }
#logmsg dd { margin: 0; padding: 0 0 0.5em 0; }
#logmsg dd:before { content:'\00bb';}
#logmsg table { border-spacing: 0px; border-collapse: collapse; border-top: 4px solid #fa0; border-bottom: 1px solid #fa0; background: #fff; }
#logmsg table th { text-align: left; font-weight: normal; padding: 0.2em 0.5em; border-top: 1px dotted #fa0; }
#logmsg table td { text-align: right; border-top: 1px dotted #fa0; padding: 0.2em 0.5em; }
#logmsg table thead th { text-align: center; border-bottom: 1px solid #fa0; }
#logmsg table th.Corner { text-align: left; }
#logmsg hr { border: none 0; border-top: 2px dashed #fa0; height: 1px; }
#header, #footer { color: #fff; background: #636; border: 1px #300 solid; padding: 6px; }
#patch { width: 100%; }
#patch h4 {font-family: verdana,arial,helvetica,sans-serif;font-size:10pt;padding:8px;background:#369;color:#fff;margin:0;}
#patch .propset h4, #patch .binary h4 {margin:0;}
#patch pre {padding:0;line-height:1.2em;margin:0;}
#patch .diff {width:100%;background:#eee;padding: 0 0 10px 0;overflow:auto;}
#patch .propset .diff, #patch .binary .diff {padding:10px 0;}
#patch span {display:block;padding:0 10px;}
#patch .modfile, #patch .addfile, #patch .delfile, #patch .propset, #patch .binary, #patch .copfile {border:1px solid #ccc;margin:10px 0;}
#patch ins {background:#dfd;text-decoration:none;display:block;padding:0 10px;}
#patch del {background:#fdd;text-decoration:none;display:block;padding:0 10px;}
#patch .lines, .info {color:#888;background:#fff;}
--></style>
<div id="msg">
<dl class="meta">
<dt>Revision</dt> <dd><a href="https://trac.macports.org/changeset/127178">127178</a></dd>
<dt>Author</dt> <dd>hum@macports.org</dd>
<dt>Date</dt> <dd>2014-10-22 03:36:55 -0700 (Wed, 22 Oct 2014)</dd>
</dl>
<h3>Log Message</h3>
<pre>emacs-app: update to 24.4; delete obsolete patches and variants; update inline patch.</pre>
<h3>Modified Paths</h3>
<ul>
<li><a href="#trunkdportsaquaemacsappPortfile">trunk/dports/aqua/emacs-app/Portfile</a></li>
</ul>
<h3>Added Paths</h3>
<ul>
<li><a href="#trunkdportsaquaemacsappfilespatchinline24420140820diff">trunk/dports/aqua/emacs-app/files/patch-inline-24.4-20140820.diff</a></li>
</ul>
<h3>Removed Paths</h3>
<ul>
<li><a href="#trunkdportsaquaemacsappfilespatchmacemacsjpinlinediff">trunk/dports/aqua/emacs-app/files/patch-macemacsjp-inline.diff</a></li>
<li><a href="#trunkdportsaquaemacsappfilespatchmaverickshomediff">trunk/dports/aqua/emacs-app/files/patch-mavericks-home.diff</a></li>
<li><a href="#trunkdportsaquaemacsappfilespatchmavericksmemleakdiff">trunk/dports/aqua/emacs-app/files/patch-mavericks-memleak.diff</a></li>
</ul>
</div>
<div id="patch">
<h3>Diff</h3>
<a id="trunkdportsaquaemacsappPortfile"></a>
<div class="modfile"><h4>Modified: trunk/dports/aqua/emacs-app/Portfile (127177 => 127178)</h4>
<pre class="diff"><span>
<span class="info">--- trunk/dports/aqua/emacs-app/Portfile        2014-10-22 10:34:11 UTC (rev 127177)
+++ trunk/dports/aqua/emacs-app/Portfile        2014-10-22 10:36:55 UTC (rev 127178)
</span><span class="lines">@@ -4,8 +4,7 @@
</span><span class="cx"> PortSystem 1.0
</span><span class="cx">
</span><span class="cx"> name emacs-app
</span><del>-version 24.3
-revision 5
</del><ins>+version 24.4
</ins><span class="cx"> categories aqua editors
</span><span class="cx"> maintainers hum css openmaintainer
</span><span class="cx">
</span><span class="lines">@@ -25,8 +24,8 @@
</span><span class="cx"> master_sites gnu:emacs
</span><span class="cx"> distname emacs-${version}
</span><span class="cx"> dist_subdir emacs
</span><del>-checksums rmd160 b67e847861002bbb76ae6588ff659408763313cf \
- sha256 0098ca3204813d69cd8412045ba33e8701fa2062f4bff56bedafc064979eef41
</del><ins>+checksums rmd160 52bec18c5f8e4ee7ea3b765620c0f19d2ee524c9 \
+ sha256 a93c4f1afa5ade65a0c9723975f0a5fdf6641cc4638fdafb3ed9942c23c32cc6
</ins><span class="cx">
</span><span class="cx"> conflicts emacs-app-devel
</span><span class="cx">
</span><span class="lines">@@ -38,11 +37,6 @@
</span><span class="cx">
</span><span class="cx"> patchfiles patch-src_emacs.c.diff
</span><span class="cx">
</span><del>-if {${os.platform} == "darwin" && ${os.major} >= 13} {
- patchfiles-append patch-mavericks-home.diff \
- patch-mavericks-memleak.diff
-}
-
</del><span class="cx"> post-patch {
</span><span class="cx"> reinplace "s|__PREFIX__|${prefix}|" ${worksrcpath}/src/emacs.c
</span><span class="cx"> }
</span><span class="lines">@@ -62,25 +56,15 @@
</span><span class="cx"> ${destroot}${applications_dir}/Emacs.app/Contents/Resources/site-lisp/site-start.el
</span><span class="cx"> }
</span><span class="cx">
</span><del>-variant fullscreen description {Obsolete compatibility variant} {}
-
-variant oldfullscreen description {Obsolete compatibility variant} {}
-
-variant inline description {Apply inline patch from MacEmacsJP} {
- # inline patch fetched from MacEmacsJP.
- # patch-macemacsjp-inline.diff
- # http://svn.sourceforge.jp/svnroot/macemacsjp/inline_patch/trunk/emacs-inline.patch
- # revision 583 (2013/04/13) modified for emacs-24.3.
- patchfiles-append patch-macemacsjp-inline.diff
</del><ins>+variant inline description {Apply inline patch} {
+ # inline patch for 24.4
+ # http://plamo.linet.gr.jp/~matsuki/mac/emacs-24.4-20140820-inline.patch.bz2
+ patchfiles-append patch-inline-24.4-20140820.diff
</ins><span class="cx"> # http://sakito.jp/emacs/emacs24.html
</span><span class="cx"> depends_build-append port:autoconf port:automake port:libtool
</span><span class="cx"> build.target bootstrap
</span><span class="cx"> }
</span><span class="cx">
</span><del>-variant jpfont requires inline description {Obsolete compatibility variant} {}
-
-variant patches requires inline description {Obsolete compatibility variant} {}
-
</del><span class="cx"> default_variants +inline
</span><span class="cx">
</span><span class="cx"> livecheck.type regex
</span></span></pre></div>
<a id="trunkdportsaquaemacsappfilespatchinline24420140820diff"></a>
<div class="addfile"><h4>Added: trunk/dports/aqua/emacs-app/files/patch-inline-24.4-20140820.diff (0 => 127178)</h4>
<pre class="diff"><span>
<span class="info">--- trunk/dports/aqua/emacs-app/files/patch-inline-24.4-20140820.diff         (rev 0)
+++ trunk/dports/aqua/emacs-app/files/patch-inline-24.4-20140820.diff        2014-10-22 10:36:55 UTC (rev 127178)
</span><span class="lines">@@ -0,0 +1,1240 @@
</span><ins>+diff -rcN ../emacs-24.4-20140820.orig/configure.ac configure.ac
+*** ../emacs-24.4-20140820.orig/configure.ac        2014-08-20 00:08:02.000000000 +0900
+--- configure.ac        2014-08-20 19:13:44.000000000 +0900
+***************
+*** 1825,1831 ****
+ INSTALL_ARCH_INDEP_EXTRA=
+ fi
+
+! NS_OBJC_OBJ="nsterm.o nsfns.o nsmenu.o nsselect.o nsimage.o nsfont.o $macfont_file"
+ fi
+ CFLAGS="$tmp_CFLAGS"
+ CPPFLAGS="$tmp_CPPFLAGS"
+--- 1825,1831 ----
+ INSTALL_ARCH_INDEP_EXTRA=
+ fi
+
+! NS_OBJC_OBJ="nsterm.o nsfns.o nsmenu.o nsselect.o nsimage.o nsfont.o macim.o $macfont_file"
+ fi
+ CFLAGS="$tmp_CFLAGS"
+ CPPFLAGS="$tmp_CPPFLAGS"
+***************
+*** 4880,4886 ****
+ ## 0x690 is the total size of 30 segment load commands (at 56
+ ## each); under Cocoa 31 commands are required.
+ if test "$HAVE_NS" = "yes"; then
+! libs_nsgui="-framework AppKit"
+ if test "$NS_IMPL_COCOA" = "yes"; then
+ libs_nsgui="$libs_nsgui -framework IOKit"
+ fi
+--- 4880,4886 ----
+ ## 0x690 is the total size of 30 segment load commands (at 56
+ ## each); under Cocoa 31 commands are required.
+ if test "$HAVE_NS" = "yes"; then
+! libs_nsgui="-framework AppKit -framework Carbon -framework Cocoa"
+ if test "$NS_IMPL_COCOA" = "yes"; then
+ libs_nsgui="$libs_nsgui -framework IOKit"
+ fi
+diff -rcN ../emacs-24.4-20140820.orig/lisp/term/common-win.el lisp/term/common-win.el
+*** ../emacs-24.4-20140820.orig/lisp/term/common-win.el        2014-08-20 00:08:02.000000000 +0900
+--- lisp/term/common-win.el        2014-08-20 19:13:44.000000000 +0900
+***************
+*** 136,141 ****
+--- 136,142 ----
+          (cons (logior (lsh 0 16) 12) 'ns-new-frame)
+          (cons (logior (lsh 0 16) 13) 'ns-toggle-toolbar)
+          (cons (logior (lsh 0 16) 14) 'ns-show-prefs)
++          (cons (logior (lsh 0 16) 15) 'mac-change-input-method)
+          ))))
+ (set-terminal-parameter frame 'x-setup-function-keys t)))
+
+diff -rcN ../emacs-24.4-20140820.orig/lisp/term/ns-win.el lisp/term/ns-win.el
+*** ../emacs-24.4-20140820.orig/lisp/term/ns-win.el        2014-08-20 00:08:02.000000000 +0900
+--- lisp/term/ns-win.el        2014-08-20 19:13:44.000000000 +0900
+***************
+*** 168,173 ****
+--- 168,174 ----
+ (define-key global-map [ns-new-frame] 'make-frame)
+ (define-key global-map [ns-toggle-toolbar] 'ns-toggle-toolbar)
+ (define-key global-map [ns-show-prefs] 'customize)
++ (define-key global-map [mac-change-input-method] 'mac-change-input-method)
+
+
+ ;; Set up a number of aliases and other layers to pretend we're using
+***************
+*** 253,266 ****
+ ;; editing window.)
+
+ (defface ns-working-text-face
+! '((t :underline t))
+ "Face used to highlight working text during compose sequence insert."
+ :group 'ns)
+
+ (defvar ns-working-overlay nil
+ "Overlay used to highlight working text during compose sequence insert.
+ When text is in th echo area, this just stores the length of the working text.")
+
+ (defvar ns-working-text)                nsterm.m
+
+ ;; Test if in echo area, based on mac-win.el 2007/08/26 unicode-2.
+--- 254,283 ----
+ ;; editing window.)
+
+ (defface ns-working-text-face
+! '((((background dark)) :underline "gray80")
+! (t :underline "gray20"))
+ "Face used to highlight working text during compose sequence insert."
+ :group 'ns)
+
++ (defface ns-marked-text-face
++ '((((background dark)) :underline "gray80")
++ (t :underline "gray20"))
++ "Face used to highlight marked text during compose sequence insert."
++ :group 'ns)
++
++ (defface ns-unmarked-text-face
++ '((((background dark)) :underline "gray20")
++ (t :underline "gray80"))
++ "Face used to highlight marked text during compose sequence insert."
++ :group 'ns)
++
+ (defvar ns-working-overlay nil
+ "Overlay used to highlight working text during compose sequence insert.
+ When text is in th echo area, this just stores the length of the working text.")
+
++ (defvar ns-marked-overlay nil
++ "Overlay used to highlight marked text during compose sequence insert.")
++
+ (defvar ns-working-text)                nsterm.m
+
+ ;; Test if in echo area, based on mac-win.el 2007/08/26 unicode-2.
+***************
+*** 268,284 ****
+ (defun ns-in-echo-area ()
+ "Whether, for purposes of inserting working composition text, the minibuffer
+ is currently being used."
+! (or isearch-mode
+! (and cursor-in-echo-area (current-message))
+! ;; Overlay strings are not shown in some cases.
+! (get-char-property (point) 'invisible)
+! (and (not (bobp))
+!          (or (and (get-char-property (point) 'display)
+!                  (eq (get-char-property (1- (point)) 'display)
+!                         (get-char-property (point) 'display)))
+!          (and (get-char-property (point) 'composition)
+!                  (eq (get-char-property (1- (point)) 'composition)
+!                         (get-char-property (point) 'composition)))))))
+
+ ;; The 'interactive' here stays for subinvocations, so the ns-in-echo-area
+ ;; always returns nil for some reason. If this WASN'T the case, we could
+--- 285,303 ----
+ (defun ns-in-echo-area ()
+ "Whether, for purposes of inserting working composition text, the minibuffer
+ is currently being used."
+! (setq mac-in-echo-area
+!         (or isearch-mode
+!          (and cursor-in-echo-area (current-message))
+!          ;; Overlay strings are not shown in some cases.
+!          (get-char-property (point) 'invisible)
+!          (and (not (bobp))
+!                  (or (and (get-char-property (point) 'display)
+!                          (eq (get-char-property (1- (point)) 'display)
+!                          (get-char-property (point) 'display)))
+!                  (and (get-char-property (point) 'composition)
+!                          (eq (get-char-property (1- (point)) 'composition)
+!                          (get-char-property (point) 'composition)))))))
+! mac-in-echo-area)
+
+ ;; The 'interactive' here stays for subinvocations, so the ns-in-echo-area
+ ;; always returns nil for some reason. If this WASN'T the case, we could
+***************
+*** 287,292 ****
+--- 306,312 ----
+ (defun ns-put-working-text ()
+ (interactive)
+ (if (ns-in-echo-area) (ns-echo-working-text) (ns-insert-working-text)))
++
+ (defun ns-unput-working-text ()
+ (interactive)
+ (ns-delete-working-text))
+***************
+*** 308,326 ****
+ (defun ns-echo-working-text ()
+ "Echo contents of `ns-working-text' in message display area.
+ See `ns-insert-working-text'."
+- (ns-delete-working-text)
+ (let* ((msg (current-message))
+!          (msglen (length msg))
+!          message-log-max)
+ (setq ns-working-overlay (length ns-working-text))
+ (setq msg (concat msg ns-working-text))
+ (put-text-property msglen (+ msglen ns-working-overlay)
+!                  'face 'ns-working-text-face msg)
+ (message "%s" msg)))
+
+ (defun ns-delete-working-text()
+! "Delete working text and clear `ns-working-overlay'."
+ (interactive)
+ (cond
+ ((and (overlayp ns-working-overlay)
+ ;; Still alive?
+--- 328,408 ----
+ (defun ns-echo-working-text ()
+ "Echo contents of `ns-working-text' in message display area.
+ See `ns-insert-working-text'."
+ (let* ((msg (current-message))
+! (msglen (length msg))
+! message-log-max)
+! (if (integerp ns-working-overlay)
+!         (progn
+!          (setq msg (substring msg 0 (- (length msg) ns-working-overlay)))
+!          (setq msglen (length msg))))
+ (setq ns-working-overlay (length ns-working-text))
+ (setq msg (concat msg ns-working-text))
+ (put-text-property msglen (+ msglen ns-working-overlay)
+!                         'face 'ns-working-text-face msg)
+! (message "%s" msg)))
+!
+! (defun ns-put-marked-text (event)
+! (interactive "e")
+!
+! (let ((pos (nth 1 event))
+!         (len (nth 2 event)))
+! (if (ns-in-echo-area)
+!         (ns-echo-marked-text pos len)
+! (ns-insert-marked-text pos len))))
+!
+! (defun ns-insert-marked-text (pos len)
+! "Insert contents of `ns-working-text' as UTF-8 string and mark with
+! `ns-working-overlay' and `ns-marked-overlay'. Any previously existing
+! working text is cleared first. The overlay is assigned the faces
+! `ns-working-text-face' and `ns-marked-text-face'."
+! (ns-delete-working-text)
+! (let ((start (point)))
+! (if (<= pos (length ns-working-text))
+! (progn
+!         (put-text-property pos len 'face 'ns-working-text-face ns-working-text)
+!         (insert ns-working-text)
+!         (if (= len 0)
+!          (overlay-put (setq ns-working-overlay
+!                          (make-overlay start (point) (current-buffer) nil t))
+!                          'face 'ns-working-text-face)
+!          (overlay-put (setq ns-working-overlay
+!                          (make-overlay start (point) (current-buffer) nil t))
+!                  'face 'ns-unmarked-text-face)
+!          (overlay-put (setq ns-marked-overlay
+!                          (make-overlay (+ start pos) (+ start pos len)
+!                                          (current-buffer) nil t))
+!                  'face 'ns-marked-text-face))
+!         (goto-char (+ start pos))))))
+!
+! (defun ns-echo-marked-text (pos len)
+! "Echo contents of `ns-working-text' in message display area.
+! See `ns-insert-working-text'."
+! (let* ((msg (current-message))
+! (msglen (length msg))
+! message-log-max)
+! (when (integerp ns-working-overlay)
+! (setq msg (substring msg 0 (- (length msg) ns-working-overlay)))
+! (setq msglen (length msg)))
+! (setq ns-working-overlay (length ns-working-text))
+! (setq msg (concat msg ns-working-text))
+! (if (= len 0)
+! (put-text-property msglen (+ msglen ns-working-overlay)
+! 'face 'ns-working-text-face msg)
+! (put-text-property msglen (+ msglen ns-working-overlay)
+! 'face 'ns-unmarked-text-face msg)
+! (put-text-property (+ msglen pos) (+ msglen pos len)
+! 'face 'ns-marked-text-face msg))
+ (message "%s" msg)))
+
+ (defun ns-delete-working-text()
+! "Delete working text and clear `ns-working-overlay' and `ns-marked-overlay'."
+ (interactive)
++ (when (and (overlayp ns-marked-overlay)
++          ;; Still alive
++          (overlay-buffer ns-marked-overlay))
++ (with-current-buffer (overlay-buffer ns-marked-overlay)
++ (delete-overlay ns-marked-overlay)))
++ (setq ns-marked-overlay nil)
+ (cond
+ ((and (overlayp ns-working-overlay)
+ ;; Still alive?
+***************
+*** 964,969 ****
+--- 1046,1511 ----
+ (add-to-list 'window-system-initialization-alist '(ns . ns-initialize-window-system))
+
+
++ ;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;
++ ;;
++ ;; Implementation of Input Method Extension for MacOS X
++ ;; written by Taiichi Hashimoto <taiichi2@mac.com>
++ ;;
++
++ (defvar mac-input-method-parameters
++ '(
++ ("com.apple.inputmethod.Kotoeri.Roman"
++ (title . "A")
++ (cursor-color)
++ (cursor-type))
++ ("com.apple.inputmethod.Kotoeri.Japanese"
++ (title . "あ")
++ (cursor-color)
++ (cursor-type))
++ ("com.apple.inputmethod.Kotoeri.Japanese.Katakana"
++ (title . "ア")
++ (cursor-color)
++ (cursor-type))
++ ("com.apple.inputmethod.Kotoeri.Japanese.FullWidthRoman"
++ (title . "A")
++ (cursor-color)
++ (cursor-type))
++ ("com.apple.inputmethod.Kotoeri.Japanese.HalfWidthKana"
++ (title . "ア")
++ (cursor-color)
++ (cursor-type))
++ ("com.apple.inputmethod.kotoeri.Ainu"
++ (title . "アイヌ")
++ (cursor-color)
++ (cursor-type))
++ ("com.apple.inputmethod.Korean.2SetKorean"
++ (title . "가2")
++ (cursor-color)
++ (cursor-type))
++ ("com.apple.inputmethod.Korean.3SetKorean"
++ (title . "가3")
++ (cursor-color)
++ (cursor-type))
++ ("com.apple.inputmethod.Korean.390Sebulshik"
++ (title . "가5")
++ (cursor-color)
++ (cursor-type))
++ ("com.apple.inputmethod.Korean.GongjinCheongRomaja"
++ (title . "가G")
++ (cursor-color)
++ (cursor-type))
++ ("com.apple.inputmethod.Korean.HNCRomaja"
++ (title . "가H")
++ (cursor-color)
++ (cursor-type))
++ ("com.apple.inputmethod.Tamil.AnjalIM"
++ (title . "Anjal")
++ (cursor-color)
++ (cursor-type))
++ ("com.apple.inputmethod.Tamil.Tamil99"
++ (title . "Tamil")
++ (cursor-color)
++ (cursor-type))
++ ("com.apple.inputmethod.VietnameseIM.VietnameseSimpleTelex"
++ (title . "ST")
++ (cursor-color)
++ (cursor-type))
++ ("com.apple.inputmethod.VietnameseIM.VietnameseTelex"
++ (title . "TX")
++ (cursor-color)
++ (cursor-type))
++ ("com.apple.inputmethod.VietnameseIM.VietnameseVNI"
++ (title . "VN")
++ (cursor-color)
++ (cursor-type))
++ ("com.apple.inputmethod.VietnameseIM.VietnameseVIQR"
++ (title . "VQ")
++ (cursor-color)
++ (cursor-type))
++ ("com.apple.inputmethod.SCIM.ITABC"
++ (title . "拼")
++ (cursor-color)
++ (cursor-type))
++ ("com.apple.inputmethod.SCIM.WBX"
++ (title . "型")
++ (cursor-color)
++ (cursor-type))
++ ("com.apple.inputmethod.SCIM.WBH"
++ (title . "画")
++ (cursor-color)
++ (cursor-type))
++ ("com.apple.inputmethod.TCIM.Zhuyin"
++ (title . "注")
++ (cursor-color)
++ (cursor-type))
++ ("com.apple.inputmethod.TCIM.Pinyin"
++ (title . "拼")
++ (cursor-color)
++ (cursor-type))
++ ("com.apple.inputmethod.TCIM.Cangjie"
++ (title . "倉")
++ (cursor-color)
++ (cursor-type))
++ ("com.apple.inputmethod.TCIM.Jianyi"
++ (title . "速")
++ (cursor-color)
++ (cursor-type))
++ ("com.apple.inputmethod.TCIM.Dayi"
++ (title . "易")
++ (cursor-color)
++ (cursor-type))
++ ("com.apple.inputmethod.TCIM.Hanin"
++ (title . "漢")
++ (cursor-color)
++ (cursor-type))
++ ("com.google.inputmethod.Japanese.Roman"
++ (title . "G")
++ (cursor-color)
++ (cursor-type))
++ ("com.google.inputmethod.Japanese.base"
++ (title . "ぐ")
++ (cursor-color)
++ (cursor-type))
++ ("com.google.inputmethod.Japanese.Katakana"
++ (title . "グ")
++ (cursor-color)
++ (cursor-type))
++ ("com.google.inputmethod.Japanese.FullWidthRoman"
++ (title . "G")
++ (cursor-color)
++ (cursor-type))
++ ("com.google.inputmethod.Japanese.HalfWidthKana"
++ (title . "グ")
++ (cursor-color)
++ (cursor-type))
++ ("jp.monokakido.inputmethod.Kawasemi.Roman"
++ (title . "K")
++ (cursor-color)
++ (cursor-type))
++ ("jp.monokakido.inputmethod.Kawasemi.Japanese"
++ (title . "か")
++ (cursor-color)
++ (cursor-type))
++ ("jp.monokakido.inputmethod.Kawasemi.Japanese.Katakana"
++ (title . "カ")
++ (cursor-color)
++ (cursor-type))
++ ("jp.monokakido.inputmethod.Kawasemi.Japanese.FullWidthRoman"
++ (title . "K")
++ (cursor-color)
++ (cursor-type))
++ ("jp.monokakido.inputmethod.Kawasemi.Japanese.HalfWidthKana"
++ (title . "カ")
++ (cursor-color)
++ (cursor-type))
++ ("jp.monokakido.inputmethod.Kawasemi.Japanese.HalfWidthRoman"
++ (title . "_K")
++ (cursor-color)
++ (cursor-type))
++ ("jp.monokakido.inputmethod.Kawasemi.Japanese.Code"
++ (title . "C")
++ (cursor-color)
++ (cursor-type))
++ ("com.justsystems.inputmethod.atok21.Roman"
++ (title . "A")
++ (cursor-color)
++ (cursor-type))
++ ("com.justsystems.inputmethod.atok21.Japanese"
++ (title . "あ")
++ (cursor-color)
++ (cursor-type))
++ ("com.justsystems.inputmethod.atok21.Japanese.Katakana"
++ (title . "ア")
++ (cursor-color)
++ (cursor-type))
++ ("com.justsystems.inputmethod.atok21.Japanese.FullWidthRoman"
++ (title . "英")
++ (cursor-color)
++ (cursor-type))
++ ("com.justsystems.inputmethod.atok21.Japanese.HalfWidthEiji"
++ (title . "半英")
++ (cursor-color)
++ (cursor-type))
++ ("com.justsystems.inputmethod.atok22.Roman"
++ (title . "A")
++ (cursor-color)
++ (cursor-type))
++ ("com.justsystems.inputmethod.atok22.Japanese"
++ (title . "あ")
++ (cursor-color)
++ (cursor-type))
++ ("com.justsystems.inputmethod.atok22.Japanese.Katakana"
++ (title . "ア")
++ (cursor-color)
++ (cursor-type))
++ ("com.justsystems.inputmethod.atok22.Japanese.FullWidthRoman"
++ (title . "英")
++ (cursor-color)
++ (cursor-type))
++ ("com.justsystems.inputmethod.atok22.Japanese.HalfWidthEiji"
++ (title . "半英")
++ (cursor-color)
++ (cursor-type))
++ ("com.justsystems.inputmethod.atok23.Roman"
++ (title . "A")
++ (cursor-color)
++ (cursor-type))
++ ("com.justsystems.inputmethod.atok23.Japanese"
++ (title . "あ")
++ (cursor-color)
++ (cursor-type))
++ ("com.justsystems.inputmethod.atok23.Japanese.Katakana"
++ (title . "ア")
++ (cursor-color)
++ (cursor-type))
++ ("com.justsystems.inputmethod.atok23.Japanese.FullWidthRoman"
++ (title . "英")
++ (cursor-color)
++ (cursor-type))
++ ("com.justsystems.inputmethod.atok23.Japanese.HalfWidthEiji"
++ (title . "半英")
++ (cursor-color)
++ (cursor-type))
++ ("com.justsystems.inputmethod.atok24.Roman"
++ (title . "A")
++ (cursor-color)
++ (cursor-type))
++ ("com.justsystems.inputmethod.atok24.Japanese"
++ (title . "あ")
++ (cursor-color)
++ (cursor-type))
++ ("com.justsystems.inputmethod.atok24.Japanese.Katakana"
++ (title . "ア")
++ (cursor-color)
++ (cursor-type))
++ ("com.justsystems.inputmethod.atok24.Japanese.FullWidthRoman"
++ (title . "英")
++ (cursor-color)
++ (cursor-type))
++ ("com.justsystems.inputmethod.atok24.Japanese.HalfWidthEiji"
++ (title . "半英")
++ (cursor-color)
++ (cursor-type))
++ ("com.justsystems.inputmethod.atok25.Roman"
++ (title . "A")
++ (cursor-color)
++ (cursor-type))
++ ("com.justsystems.inputmethod.atok25.Japanese"
++ (title . "あ")
++ (cursor-color)
++ (cursor-type))
++ ("com.justsystems.inputmethod.atok25.Japanese.Katakana"
++ (title . "ア")
++ (cursor-color)
++ (cursor-type))
++ ("com.justsystems.inputmethod.atok25.Japanese.FullWidthRoman"
++ (title . "英")
++ (cursor-color)
++ (cursor-type))
++ ("com.justsystems.inputmethod.atok25.Japanese.HalfWidthEiji"
++ (title . "半英")
++ (cursor-color)
++ (cursor-type))
++ )
++ "Alist of Mac script code vs parameters for input method on MacOSX.")
++
++
++ (defun mac-get-input-method-parameter (is key)
++ "Function to get a parameter of a input method."
++ (interactive)
++ (assq key (cdr (assoc is mac-input-method-parameters))))
++
++ (defun mac-get-input-method-title (&optional input-source)
++ "Return input method title of input source.
++ If input-source is nil, return one of current frame."
++ (if input-source
++ (cdr (mac-get-input-method-parameter input-source 'title))
++ current-input-method-title))
++
++ (defun mac-get-cursor-type (&optional input-source)
++ "Return cursor type of input source.
++ If input-source is nil, return one of current frame."
++ (if input-source
++ (or (cdr (mac-get-input-method-parameter input-source 'cursor-type))
++          (cdr (assq 'cursor-type default-frame-alist))
++          cursor-type)
++ (cdr (assq 'cursor-type (frame-parameters (selected-frame))))))
++
++ (defun mac-get-cursor-color (&optional input-source)
++ "Return cursor color of input source.
++ If input-source is nil, return one of current frame."
++ (if input-source
++ (or (cdr (mac-get-input-method-parameter input-source 'cursor-color))
++          (cdr (assq 'cursor-color default-frame-alist)))
++ (cdr (assq 'cursor-color (frame-parameters (selected-frame))))))
++
++
++ (defun mac-set-input-method-parameter (is key value)
++ "Function to set a parameter of a input method."
++ (let* ((is-param (assoc is mac-input-method-parameters))
++ (param (assq key is-param)))
++ (if is-param
++         (if param
++          (setcdr param value)
++          (setcdr is-param (cons (cons key value) (cdr is-param))))
++ (setq mac-input-method-parameters
++          (cons (list is (cons key value))
++                  mac-input-method-parameters)))))
++
++
++ (defun mac-input-method-update (is)
++ "Funtion to update parameters of a input method."
++ (interactive)
++
++ (let ((title (mac-get-input-method-title is))
++ (type (mac-get-cursor-type is))
++ (color (mac-get-cursor-color is)))
++ (if (and title (not (equal title (mac-get-input-method-title))))
++         (setq current-input-method-title title))
++ (if (and type (not (equal type (mac-get-cursor-type))))
++         (setq cursor-type type))
++ (if (and color (not (equal color (mac-get-cursor-color))))
++         (set-cursor-color color))
++ (force-mode-line-update)
++ (if isearch-mode (isearch-update))))
++
++
++ (defun mac-toggle-input-method (&optional arg)
++ "Function to toggle input method on MacOSX."
++ (interactive)
++
++ (if arg
++ (progn
++         (make-local-variable 'input-method-function)
++         (setq inactivate-current-input-method-function 'mac-toggle-input-method)
++         (setq input-method-function nil)
++         (setq describe-current-input-method-function nil)
++         (mac-toggle-input-source t))
++ (kill-local-variable 'input-method-function)
++ (setq describe-current-input-method-function nil)
++ (mac-toggle-input-source nil)))
++
++
++ (defun mac-change-language-to-us ()
++ "Function to change language to us."
++ (interactive)
++ (mac-toggle-input-method nil))
++
++
++ (defun mac-handle-input-method-change ()
++ "Function run when a input method change."
++ (interactive)
++
++ (if (equal default-input-method "MacOSX")
++ (let ((input-source (mac-get-current-input-source))
++          (ascii-capable (mac-input-source-is-ascii-capable)))
++         
++         (cond ((and (not current-input-method) (not ascii-capable))
++          (set-input-method "MacOSX"))
++          ((and (equal current-input-method "MacOSX") ascii-capable)
++          (toggle-input-method nil)))
++         (mac-input-method-update input-source))))
++
++ ;;
++ ;; Emacs input method for input method on MacOSX.
++ ;;
++ (register-input-method "MacOSX" "MacOSX" 'mac-toggle-input-method
++                  "Mac" "Input Method on MacOSX System")
++
++
++ ;;
++ ;; Minor mode of using input methods on MacOS X
++ ;;
++ (define-minor-mode mac-input-method-mode
++ "Use input methods on MacOSX."
++ :init-value nil
++ :group 'ns
++ :global t
++
++ (if mac-input-method-mode
++ (progn
++         (setq default-input-method "MacOSX")
++         (add-hook 'minibuffer-setup-hook 'mac-change-language-to-us)
++         (mac-translate-from-yen-to-backslash))
++ (setq default-input-method nil)))
++
++ ;;
++ ;; Valiable and functions to pass key(shortcut) to system.
++ ;;
++ (defvar mac-keys-passed-to-system nil
++ "A list of keys passed to system on MacOSX.")
++
++ (defun mac-add-key-passed-to-system (key)
++ (let ((shift '(shift shft))
++         (control '(control ctrl ctl))
++         (option '(option opt alternate alt))
++         (command '(command cmd)))
++
++ (add-to-list 'mac-keys-passed-to-system
++                  (cond ((symbolp key)
++                         (cond ((memq key shift)
++                          (cons ns-shift-key-mask nil))
++                          ((memq key control)
++                          (cons ns-control-key-mask nil))
++                          ((memq key option)
++                          (cons ns-alternate-key-mask nil))
++                          ((memq key command)
++                          (cons ns-command-key-mask nil))
++                          (t (cons nil nil))))
++                  ((numberp key) (cons 0 key))
++                  ((listp key)
++                         (let ((l key) (k nil) (m 0))
++                          (while l
++                          (cond ((memq (car l) shift)
++                                  (setq m (logior m ns-shift-key-mask)))
++                                  ((memq (car l) control)
++                                  (setq m (logior m ns-control-key-mask)))
++                                  ((memq (car l) option)
++                                  (setq m (logior m ns-alternate-key-mask)))
++                                  ((memq (car l) command)
++                                  (setq m (logior m ns-command-key-mask)))
++                                  ((numberp (car l))
++                                  (if (not k) (setq k (car l)))))
++                          (setq l (cdr l)))
++                          (cons m k)))
++                  (t (cons nil nil))))))
++
++
++ ;;
++ ;; Entry Emacs event for inline input method on MacOSX.
++ ;;
++ (define-key special-event-map
++ [mac-change-input-method] 'mac-handle-input-method-change)
++
++ ;;
++ ;; Convert yen to backslash for JIS keyboard.
++ ;;
++ (defun mac-translate-from-yen-to-backslash ()
++ ;; Convert yen to backslash for JIS keyboard.
++ (interactive)
++
++ (define-key global-map [165] nil)
++ (define-key global-map [2213] nil)
++ (define-key global-map [3420] nil)
++ (define-key global-map [67109029] nil)
++ (define-key global-map [67111077] nil)
++ (define-key global-map [8388773] nil)
++ (define-key global-map [134219941] nil)
++ (define-key global-map [75497596] nil)
++ (define-key global-map [201328805] nil)
++ (define-key function-key-map [165] [?\\])
++ (define-key function-key-map [2213] [?\\]) ;; for Intel
++ (define-key function-key-map [3420] [?\\]) ;; for PowerPC
++ (define-key function-key-map [67109029] [?\C-\\])
++ (define-key function-key-map [67111077] [?\C-\\])
++ (define-key function-key-map [8388773] [?\M-\\])
++ (define-key function-key-map [134219941] [?\M-\\])
++ (define-key function-key-map [75497596] [?\C-\M-\\])
++ (define-key function-key-map [201328805] [?\C-\M-\\])
++ )
++
++ ;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;
++
+ (provide 'ns-win)
+
+ ;;; ns-win.el ends here
+diff -rcN ../emacs-24.4-20140820.orig/src/Makefile.in src/Makefile.in
+*** ../emacs-24.4-20140820.orig/src/Makefile.in        2014-08-20 00:08:02.000000000 +0900
+--- src/Makefile.in        2014-08-20 19:13:44.000000000 +0900
+***************
+*** 366,373 ****
+ SOME_MACHINE_OBJECTS = dosfns.o msdos.o \
+ xterm.o xfns.o xmenu.o xselect.o xrdb.o xsmfns.o fringe.o image.o \
+ fontset.o dbusbind.o cygw32.o \
+! nsterm.o nsfns.o nsmenu.o nsselect.o nsimage.o nsfont.o macfont.o \
+! w32.o w32console.o w32fns.o w32heap.o w32inevt.o w32notify.o \
+ w32menu.o w32proc.o w32reg.o w32select.o w32term.o w32xfns.o \
+ w16select.o widget.o xfont.o ftfont.o xftfont.o ftxfont.o gtkutil.o \
+ xsettings.o xgselect.o termcap.o
+--- 366,373 ----
+ SOME_MACHINE_OBJECTS = dosfns.o msdos.o \
+ xterm.o xfns.o xmenu.o xselect.o xrdb.o xsmfns.o fringe.o image.o \
+ fontset.o dbusbind.o cygw32.o \
+! nsterm.o nsfns.o nsmenu.o nsselect.o nsimage.o nsfont.o macfont.o macim.o \
+! w32.o w32console.o w32fns.o w32heap.o w32inevt.o \
+ w32menu.o w32proc.o w32reg.o w32select.o w32term.o w32xfns.o \
+ w16select.o widget.o xfont.o ftfont.o xftfont.o ftxfont.o gtkutil.o \
+ xsettings.o xgselect.o termcap.o
+diff -rcN ../emacs-24.4-20140820.orig/src/keyboard.c src/keyboard.c
+*** ../emacs-24.4-20140820.orig/src/keyboard.c        2014-08-20 00:08:02.000000000 +0900
+--- src/keyboard.c        2014-08-20 19:13:44.000000000 +0900
+***************
+*** 3965,3972 ****
+ {
+ if (event->code == KEY_NS_PUT_WORKING_TEXT)
+ obj = list1 (intern ("ns-put-working-text"));
+! else
+ obj = list1 (intern ("ns-unput-working-text"));
+          kbd_fetch_ptr = event + 1;
+ if (used_mouse_menu)
+ *used_mouse_menu = 1;
+--- 3965,3974 ----
+ {
+ if (event->code == KEY_NS_PUT_WORKING_TEXT)
+ obj = list1 (intern ("ns-put-working-text"));
+! else if (event->code == KEY_NS_UNPUT_WORKING_TEXT)
+ obj = list1 (intern ("ns-unput-working-text"));
++          else if (event->code == KEY_NS_PUT_MARKED_TEXT)
++          obj = Fcons (intern ("ns-put-marked-text"), event->arg);
+          kbd_fetch_ptr = event + 1;
+ if (used_mouse_menu)
+ *used_mouse_menu = 1;
+***************
+*** 11753,11758 ****
+--- 11755,11762 ----
+                          "ns-put-working-text");
+ initial_define_lispy_key (Vspecial_event_map, "ns-unput-working-text",
+                          "ns-unput-working-text");
++ initial_define_lispy_key (Vspecial_event_map, "ns-put-marked-text",
++                          "ns-put-marked-text");
+ /* Here we used to use `ignore-event' which would simple set prefix-arg to
+ current-prefix-arg, as is done in `handle-switch-frame'.
+ But `handle-switch-frame is not run from the special-map.
+diff -rcN ../emacs-24.4-20140820.orig/src/macim.m src/macim.m
+*** ../emacs-24.4-20140820.orig/src/macim.m        1970-01-01 09:00:00.000000000 +0900
+--- src/macim.m        2014-08-20 19:13:44.000000000 +0900
+***************
+*** 0 ****
+--- 1,173 ----
++ /* Implementation of Input Method Extension for MacOS X.
++ Copyright (C) 2004, 2005, 2006, 2007, 2008, 2009, 2010, 2011
++ Taiichi Hashimoto <taiichi2@mac.com>.
++ */
++
++ #include "config.h"
++
++ #ifdef NS_IMPL_COCOA
++
++ #include <math.h>
++ #include <sys/types.h>
++ #include <time.h>
++ #include <signal.h>
++ #include <unistd.h>
++
++ #include <Carbon/Carbon.h>
++
++ #include "lisp.h"
++ #include "blockinput.h"
++
++ #include "termhooks.h"
++ #include "keyboard.h"
++ #include "buffer.h"
++
++ //extern Lisp_Object Qcurrent_input_method;
++ //extern int cursor_in_echo_area;
++ static Lisp_Object Qmac_keys_passed_to_system;
++
++ void mac_init_input_method ();
++ int mac_pass_key_to_system (int code, int modifiers);
++ int mac_pass_key_directly_to_emacs ();
++ int mac_store_change_input_method_event ();
++
++ DEFUN ("mac-input-source-is-ascii-capable", Fmac_input_source_is_ascii_capable, Smac_input_source_is_ascii_capable,
++ 0, 0, 0,
++ doc: /* Is current input source ascii capable? */)
++ (void)
++ {
++ TISInputSourceRef is = TISCopyCurrentKeyboardInputSource();
++ CFBooleanRef ret = TISGetInputSourceProperty(is, kTISPropertyInputSourceIsASCIICapable);
++
++ return CFBooleanGetValue(ret)? Qt : Qnil;
++ }
++
++ DEFUN ("mac-get-input-source-list", Fmac_get_input_source_list, Smac_get_input_source_list,
++ 0, 0, 0,
++ doc: /* get input source list on MacOSX */)
++ (void)
++ {
++ NSArray *is_list = (NSArray *)TISCreateInputSourceList(NULL, false);
++ int list_size = [is_list count];
++ Lisp_Object list[list_size];
++ int i;
++
++ for (i = 0; i < list_size; i++) {
++ TISInputSourceRef is = (TISInputSourceRef)[is_list objectAtIndex:i];
++ NSString *id = (NSString *)TISGetInputSourceProperty(is, kTISPropertyInputSourceID);
++ list[i] = make_string([id UTF8String],
++                          [id lengthOfBytesUsingEncoding:NSUTF8StringEncoding]);
++ }
++
++ return Flist(list_size, list);
++ }
++
++ DEFUN ("mac-get-current-input-source", Fmac_get_current_input_source, Smac_get_current_input_source,
++ 0, 0, 0,
++ doc: /* get current input source on MacOSX */)
++ (void)
++ {
++ TISInputSourceRef is = TISCopyCurrentKeyboardInputSource();
++ NSString *id = (NSString *)TISGetInputSourceProperty(is, kTISPropertyInputSourceID);
++
++ return make_string([id UTF8String],
++                  [id lengthOfBytesUsingEncoding:NSUTF8StringEncoding]);
++ }
++
++ DEFUN ("mac-toggle-input-source", Fmac_toggle_input_source, Smac_toggle_input_source,
++ 1, 1, 0,
++ doc: /* toggle input source on MacOSX */)
++ (arg)
++ Lisp_Object arg;
++ {
++ TISInputSourceRef is = NULL;
++
++ if (NILP (arg))
++ {
++ is = TISCopyCurrentASCIICapableKeyboardInputSource();
++ }
++ else
++ {
++ NSString *locale;
++ NSArray *languages = [NSLocale preferredLanguages];
++ if (languages != nil) {
++          locale = [languages objectAtIndex:0];
++ } else {
++          locale = [[NSLocale currentLocale]
++                          objectForKey:NSLocaleLanguageCode];
++ }
++ is = TISCopyInputSourceForLanguage((CFStringRef)locale);
++ }
++ if (is) TISSelectInputSource(is);
++
++ return arg;
++ }
++
++ int
++ mac_store_change_input_method_event ()
++ {
++ Lisp_Object dim;
++ int ret = FALSE;
++
++ dim = Fsymbol_value (intern ("default-input-method"));
++ if (STRINGP (dim) && strcmp(SDATA (dim), "MacOSX") == 0)
++ {
++ ret = TRUE;
++ }
++
++ return ret;
++ }
++
++ int
++ mac_pass_key_to_system (int code, int modifiers)
++ {
++ Lisp_Object keys = Fsymbol_value (Qmac_keys_passed_to_system);
++ Lisp_Object m, k;
++
++ while (!NILP (keys))
++ {
++ m = XCAR (XCAR (keys));
++ k = XCDR (XCAR (keys));
++ keys = XCDR (keys);
++
++ if (NUMBERP (m) && modifiers == XINT (m))
++         if (NILP (k)
++          || (NUMBERP (k) && code == XINT (k)))
++          return TRUE;
++ }
++
++ return FALSE;
++ }
++
++ int
++ mac_pass_key_directly_to_emacs (void)
++ {
++
++ if (NILP (Fmac_input_source_is_ascii_capable()))
++ {
++ if (NILP (Vmac_use_input_method_on_system)
++          || this_command_key_count
++          || cursor_in_echo_area
++          || !NILP (BVAR (current_buffer, read_only)))
++         return TRUE;
++ }
++
++ return FALSE;
++ }
++
++
++ void mac_init_input_method (void)
++ {
++ Qmac_keys_passed_to_system = intern ("mac-keys-passed-to-system");
++ staticpro (&Qmac_keys_passed_to_system);
++
++ DEFVAR_LISP ("mac-use-input-method-on-system", Vmac_use_input_method_on_system,
++ doc: /* If it is non-nil, use input method on system. */);
++ Vmac_use_input_method_on_system = Qt;
++
++ defsubr (&Smac_input_source_is_ascii_capable);
++ defsubr (&Smac_get_input_source_list);
++ defsubr (&Smac_get_current_input_source);
++ defsubr (&Smac_toggle_input_source);
++ }
++ #endif
+diff -rcN ../emacs-24.4-20140820.orig/src/nsfns.m src/nsfns.m
+*** ../emacs-24.4-20140820.orig/src/nsfns.m        2014-08-20 00:08:02.000000000 +0900
+--- src/nsfns.m        2014-08-20 19:13:44.000000000 +0900
+***************
+*** 546,552 ****
+ ns_set_name_internal (f, name);
+ }
+
+-
+ void
+ ns_set_name_as_filename (struct frame *f)
+ {
+--- 546,551 ----
+***************
+*** 2987,2992 ****
+--- 2986,3009 ----
+ doc: /* Toolkit version for NS Windowing. */);
+ Vns_version_string = ns_appkit_version_str ();
+
++
++ DEFVAR_LISP ("ns-shift-key-mask", Vns_shift_key_mask,
++ doc: /* Shift key mask defined in system. */);
++ Vns_shift_key_mask = make_number (NSShiftKeyMask);
++
++ DEFVAR_LISP ("ns-control-key-mask", Vns_control_key_mask,
++ doc: /* Control key mask defined in system. */);
++ Vns_control_key_mask = make_number (NSControlKeyMask);
++
++ DEFVAR_LISP ("ns-alternate-key-mask", Vns_alternate_key_mask,
++ doc: /* Alternate key mask defined in system. */);
++ Vns_alternate_key_mask = make_number (NSAlternateKeyMask);
++
++ DEFVAR_LISP ("ns-command-key-mask", Vns_command_key_mask,
++ doc: /* Command key mask defined in system. */);
++ Vns_command_key_mask = make_number (NSCommandKeyMask);
++
++
+ defsubr (&Sns_read_file_name);
+ defsubr (&Sns_get_resource);
+ defsubr (&Sns_set_resource);
+***************
+*** 3030,3035 ****
+--- 3047,3056 ----
+ defsubr (&Sx_show_tip);
+ defsubr (&Sx_hide_tip);
+
++ #ifdef NS_IMPL_COCOA
++ mac_init_input_method ();
++ #endif
++
+ as_status = 0;
+ as_script = Qnil;
+ as_result = 0;
+diff -rcN ../emacs-24.4-20140820.orig/src/nsterm.h src/nsterm.h
+*** ../emacs-24.4-20140820.orig/src/nsterm.h        2014-08-20 00:08:02.000000000 +0900
+--- src/nsterm.h        2014-08-20 19:13:44.000000000 +0900
+***************
+*** 482,487 ****
+--- 482,489 ----
+ #define KEY_NS_NEW_FRAME ((1<<28)|(0<<16)|12)
+ #define KEY_NS_TOGGLE_TOOLBAR ((1<<28)|(0<<16)|13)
+ #define KEY_NS_SHOW_PREFS ((1<<28)|(0<<16)|14)
++ #define KEY_MAC_CHANGE_INPUT_METHOD ((1<<28)|(0<<16)|15)
++ #define KEY_NS_PUT_MARKED_TEXT ((1<<28)|(0<<16)|16)
+
+ /* could use list to store these, but rest of emacs has a big infrastructure
+ for managing a table of bitmap "records" */
+diff -rcN ../emacs-24.4-20140820.orig/src/nsterm.m src/nsterm.m
+*** ../emacs-24.4-20140820.orig/src/nsterm.m        2014-08-20 00:08:02.000000000 +0900
+--- src/nsterm.m        2014-08-20 19:13:44.000000000 +0900
+***************
+*** 4262,4267 ****
+--- 4262,4270 ----
+ /* [[NSNotificationCenter defaultCenter] addObserver: NSApp
+ selector: @selector (logNotification:)
+ name: nil object: nil]; */
++ [[NSDistributedNotificationCenter defaultCenter] addObserver: NSApp
++                                         selector: @selector (changeInputMethod:)
++                                                  name: @"AppleSelectedInputSourcesChangedNotification" object: nil];
+
+ dpyinfo = xzalloc (sizeof *dpyinfo);
+
+***************
+*** 4539,4544 ****
+--- 4542,4562 ----
+ NSLog (@"notification: '%@'", [notification name]);
+ }
+
++ - (void)changeInputMethod: (NSNotification *)notification
++ {
++
++ struct frame *emacsframe = SELECTED_FRAME ();
++
++ if (mac_store_change_input_method_event())
++ {
++ if (!emacs_event)
++         return;
++ emacs_event->kind = NS_NONKEY_EVENT;
++ emacs_event->code = KEY_MAC_CHANGE_INPUT_METHOD;
++ emacs_event->modifiers = 0;
++ EV_TRAILER ((id)nil);
++ }
++ }
+
+ - (void)sendEvent: (NSEvent *)theEvent
+ /* --------------------------------------------------------------------------
+***************
+*** 5315,5321 ****
+ code, fnKeysym, flags, emacs_event->modifiers);
+
+ /* if it was a function key or had modifiers, pass it directly to emacs */
+! if (fnKeysym || (emacs_event->modifiers
+ && (emacs_event->modifiers != shift_modifier)
+ && [[theEvent charactersIgnoringModifiers] length] > 0))
+ /*[[theEvent characters] length] */
+--- 5333,5340 ----
+ code, fnKeysym, flags, emacs_event->modifiers);
+
+ /* if it was a function key or had modifiers, pass it directly to emacs */
+! if (mac_pass_key_directly_to_emacs ()
+!          ||fnKeysym || (emacs_event->modifiers
+ && (emacs_event->modifiers != shift_modifier)
+ && [[theEvent charactersIgnoringModifiers] length] > 0))
+ /*[[theEvent characters] length] */
+***************
+*** 5330,5338 ****
+ ? MULTIBYTE_CHAR_KEYSTROKE_EVENT : ASCII_KEYSTROKE_EVENT;
+
+ emacs_event->code = code;
+! EV_TRAILER (theEvent);
+! processingCompose = NO;
+! return;
+ }
+ }
+
+--- 5349,5367 ----
+ ? MULTIBYTE_CHAR_KEYSTROKE_EVENT : ASCII_KEYSTROKE_EVENT;
+
+ emacs_event->code = code;
+!          /* The function mac_pass_key_to_system decides
+!          whether it is passed directly to emacs or not. */
+!          if (emacs_event->kind == NON_ASCII_KEYSTROKE_EVENT
+!          || !mac_pass_key_to_system (code, flags
+!                                          & (NSShiftKeyMask
+!                                          | NSControlKeyMask
+!                                          | NSAlternateKeyMask
+!                                          | NSCommandKeyMask)))
+!          {
+!          EV_TRAILER (theEvent);
+!          processingCompose = NO;
+!          return;
+!          }
+ }
+ }
+
+***************
+*** 5432,5441 ****
+ (unsigned long)selRange.length,
+ (unsigned long)selRange.location);
+
+- if (workingText != nil)
+- [self deleteWorkingText];
+ if ([str length] == 0)
+! return;
+
+ if (!emacs_event)
+ return;
+--- 5461,5479 ----
+ (unsigned long)selRange.length,
+ (unsigned long)selRange.location);
+
+ if ([str length] == 0)
+! {
+! [self deleteWorkingText];
+! return;
+! }
+! else
+! {
+! if (workingText != nil) {
+!         [workingText release];
+!         workingText = nil;
+!         processingCompose = NO;
+! }
+! }
+
+ if (!emacs_event)
+ return;
+***************
+*** 5445,5451 ****
+ ns_working_text = build_string ([workingText UTF8String]);
+
+ emacs_event->kind = NS_TEXT_EVENT;
+! emacs_event->code = KEY_NS_PUT_WORKING_TEXT;
+ EV_TRAILER ((id)nil);
+ }
+
+--- 5483,5491 ----
+ ns_working_text = build_string ([workingText UTF8String]);
+
+ emacs_event->kind = NS_TEXT_EVENT;
+! emacs_event->code = KEY_NS_PUT_MARKED_TEXT;
+! emacs_event->arg = Fcons (make_number (selRange.location),
+!                          Fcons (make_number (selRange.length), Qnil));
+ EV_TRAILER ((id)nil);
+ }
+
+***************
+*** 5500,5514 ****
+ {
+ NSRect rect;
+ NSPoint pt;
+! struct window *win = XWINDOW (FRAME_SELECTED_WINDOW (emacsframe));
+ if (NS_KEYLOG)
+ NSLog (@"firstRectForCharRange request");
+
+ rect.size.width = theRange.length * FRAME_COLUMN_WIDTH (emacsframe);
+ rect.size.height = FRAME_LINE_HEIGHT (emacsframe);
+ pt.x = WINDOW_TEXT_TO_FRAME_PIXEL_X (win, win->phys_cursor.x);
+ pt.y = WINDOW_TO_FRAME_PIXEL_Y (win, win->phys_cursor.y
+! +FRAME_LINE_HEIGHT (emacsframe));
+
+ pt = [self convertPoint: pt toView: nil];
+ pt = [[self window] convertBaseToScreen: pt];
+--- 5540,5562 ----
+ {
+ NSRect rect;
+ NSPoint pt;
+! // struct window *win = XWINDOW (FRAME_SELECTED_WINDOW (emacsframe));
+! struct window *win;
+ if (NS_KEYLOG)
+ NSLog (@"firstRectForCharRange request");
++
++ if (NILP (Vmac_in_echo_area))
++ win = XWINDOW (FRAME_SELECTED_WINDOW (emacsframe));
++ else if (WINDOWP (echo_area_window))
++ win = XWINDOW (echo_area_window);
++ else
++ win = XWINDOW (FRAME_SELECTED_WINDOW (emacsframe));
+
+ rect.size.width = theRange.length * FRAME_COLUMN_WIDTH (emacsframe);
+ rect.size.height = FRAME_LINE_HEIGHT (emacsframe);
+ pt.x = WINDOW_TEXT_TO_FRAME_PIXEL_X (win, win->phys_cursor.x);
+ pt.y = WINDOW_TO_FRAME_PIXEL_Y (win, win->phys_cursor.y
+! +FRAME_LINE_HEIGHT (emacsframe)+2);
+
+ pt = [self convertPoint: pt toView: nil];
+ pt = [[self window] convertBaseToScreen: pt];
+***************
+*** 7783,7788 ****
+--- 7831,7840 ----
+ baseline level. The default value is nil. */);
+ x_underline_at_descent_line = 0;
+
++ DEFVAR_LISP ("mac-in-echo-area", Vmac_in_echo_area,
++ doc: /* state of cursor in echo area. */);
++ Vmac_in_echo_area = Qnil;
++
+ /* Tell Emacs about this window system. */
+ Fprovide (Qns, Qnil);
+
+diff -rcN ../emacs-24.4-20140820.orig/src/termhooks.h src/termhooks.h
+*** ../emacs-24.4-20140820.orig/src/termhooks.h        2014-08-20 00:08:02.000000000 +0900
+--- src/termhooks.h        2014-08-20 19:13:44.000000000 +0900
+***************
+*** 56,61 ****
+--- 56,62 ----
+ output_x_window,
+ output_msdos_raw,
+ output_w32,
++ output_mac,
+ output_ns
+ };
+
</ins></span></pre></div>
<a id="trunkdportsaquaemacsappfilespatchmacemacsjpinlinediff"></a>
<div class="delfile"><h4>Deleted: trunk/dports/aqua/emacs-app/files/patch-macemacsjp-inline.diff (127177 => 127178)</h4>
<pre class="diff"><span>
<span class="info">--- trunk/dports/aqua/emacs-app/files/patch-macemacsjp-inline.diff        2014-10-22 10:34:11 UTC (rev 127177)
+++ trunk/dports/aqua/emacs-app/files/patch-macemacsjp-inline.diff        2014-10-22 10:36:55 UTC (rev 127178)
</span><span class="lines">@@ -1,1269 +0,0 @@
</span><del>-diff -r -N -p -x '*.elc' ../emacs-24.3.org/lisp/term/common-win.el lisp/term/common-win.el
-*** ../emacs-24.3.org/lisp/term/common-win.el        2013-01-02 05:37:17.000000000 +0900
---- lisp/term/common-win.el        2013-04-13 21:49:53.000000000 +0900
-*************** is not used)."
-*** 127,132 ****
---- 127,133 ----
-          (cons (logior (lsh 0 16) 12) 'ns-new-frame)
-          (cons (logior (lsh 0 16) 13) 'ns-toggle-toolbar)
-          (cons (logior (lsh 0 16) 14) 'ns-show-prefs)
-+          (cons (logior (lsh 0 16) 15) 'mac-change-input-method)
-          ))))
- (set-terminal-parameter frame 'x-setup-function-keys t)))
-
-diff -r -N -p -x '*.elc' ../emacs-24.3.org/lisp/term/ns-win.el lisp/term/ns-win.el
-*** ../emacs-24.3.org/lisp/term/ns-win.el        2013-01-02 05:37:17.000000000 +0900
---- lisp/term/ns-win.el        2013-04-13 21:50:48.000000000 +0900
-*************** The properties returned may include `top
-*** 171,176 ****
---- 171,177 ----
- (define-key global-map [ns-new-frame] 'make-frame)
- (define-key global-map [ns-toggle-toolbar] 'ns-toggle-toolbar)
- (define-key global-map [ns-show-prefs] 'customize)
-+ (define-key global-map [mac-change-input-method] 'mac-change-input-method)
-
-
- ;; Set up a number of aliases and other layers to pretend we're using
-*************** The properties returned may include `top
-*** 256,269 ****
- ;; editing window.)
-
- (defface ns-working-text-face
-! '((t :underline t))
- "Face used to highlight working text during compose sequence insert."
- :group 'ns)
-
- (defvar ns-working-overlay nil
- "Overlay used to highlight working text during compose sequence insert.
- When text is in th echo area, this just stores the length of the working text.")
-
- (defvar ns-working-text)                nsterm.m
-
- ;; Test if in echo area, based on mac-win.el 2007/08/26 unicode-2.
---- 257,286 ----
- ;; editing window.)
-
- (defface ns-working-text-face
-! '((((background dark)) :underline "gray80")
-! (t :underline "gray20"))
- "Face used to highlight working text during compose sequence insert."
- :group 'ns)
-
-+ (defface ns-marked-text-face
-+ '((((background dark)) :underline "gray80")
-+ (t :underline "gray20"))
-+ "Face used to highlight marked text during compose sequence insert."
-+ :group 'ns)
-+
-+ (defface ns-unmarked-text-face
-+ '((((background dark)) :underline "gray20")
-+ (t :underline "gray80"))
-+ "Face used to highlight marked text during compose sequence insert."
-+ :group 'ns)
-+
- (defvar ns-working-overlay nil
- "Overlay used to highlight working text during compose sequence insert.
- When text is in th echo area, this just stores the length of the working text.")
-
-+ (defvar ns-marked-overlay nil
-+ "Overlay used to highlight marked text during compose sequence insert.")
-+
- (defvar ns-working-text)                nsterm.m
-
- ;; Test if in echo area, based on mac-win.el 2007/08/26 unicode-2.
-*************** When text is in th echo area, this just
-*** 271,287 ****
- (defun ns-in-echo-area ()
- "Whether, for purposes of inserting working composition text, the minibuffer
- is currently being used."
-! (or isearch-mode
-! (and cursor-in-echo-area (current-message))
-! ;; Overlay strings are not shown in some cases.
-! (get-char-property (point) 'invisible)
-! (and (not (bobp))
-!          (or (and (get-char-property (point) 'display)
-!                  (eq (get-char-property (1- (point)) 'display)
-!                         (get-char-property (point) 'display)))
-!          (and (get-char-property (point) 'composition)
-!                  (eq (get-char-property (1- (point)) 'composition)
-!                         (get-char-property (point) 'composition)))))))
-
- ;; The 'interactive' here stays for subinvocations, so the ns-in-echo-area
- ;; always returns nil for some reason. If this WASN'T the case, we could
---- 288,306 ----
- (defun ns-in-echo-area ()
- "Whether, for purposes of inserting working composition text, the minibuffer
- is currently being used."
-! (setq mac-in-echo-area
-!         (or isearch-mode
-!          (and cursor-in-echo-area (current-message))
-!          ;; Overlay strings are not shown in some cases.
-!          (get-char-property (point) 'invisible)
-!          (and (not (bobp))
-!                  (or (and (get-char-property (point) 'display)
-!                          (eq (get-char-property (1- (point)) 'display)
-!                          (get-char-property (point) 'display)))
-!                  (and (get-char-property (point) 'composition)
-!                          (eq (get-char-property (1- (point)) 'composition)
-!                          (get-char-property (point) 'composition)))))))
-! mac-in-echo-area)
-
- ;; The 'interactive' here stays for subinvocations, so the ns-in-echo-area
- ;; always returns nil for some reason. If this WASN'T the case, we could
-*************** is currently being used."
-*** 290,295 ****
---- 309,315 ----
- (defun ns-put-working-text ()
- (interactive)
- (if (ns-in-echo-area) (ns-echo-working-text) (ns-insert-working-text)))
-+
- (defun ns-unput-working-text ()
- (interactive)
- (ns-delete-working-text))
-*************** The overlay is assigned the face `ns-wor
-*** 311,329 ****
- (defun ns-echo-working-text ()
- "Echo contents of `ns-working-text' in message display area.
- See `ns-insert-working-text'."
-- (ns-delete-working-text)
- (let* ((msg (current-message))
-!          (msglen (length msg))
-!          message-log-max)
- (setq ns-working-overlay (length ns-working-text))
- (setq msg (concat msg ns-working-text))
- (put-text-property msglen (+ msglen ns-working-overlay)
-!                  'face 'ns-working-text-face msg)
- (message "%s" msg)))
-
- (defun ns-delete-working-text()
-! "Delete working text and clear `ns-working-overlay'."
- (interactive)
- (cond
- ((and (overlayp ns-working-overlay)
- ;; Still alive?
---- 331,411 ----
- (defun ns-echo-working-text ()
- "Echo contents of `ns-working-text' in message display area.
- See `ns-insert-working-text'."
- (let* ((msg (current-message))
-! (msglen (length msg))
-! message-log-max)
-! (if (integerp ns-working-overlay)
-!         (progn
-!          (setq msg (substring msg 0 (- (length msg) ns-working-overlay)))
-!          (setq msglen (length msg))))
- (setq ns-working-overlay (length ns-working-text))
- (setq msg (concat msg ns-working-text))
- (put-text-property msglen (+ msglen ns-working-overlay)
-!                         'face 'ns-working-text-face msg)
-! (message "%s" msg)))
-!
-! (defun ns-put-marked-text (event)
-! (interactive "e")
-!
-! (let ((pos (nth 1 event))
-!         (len (nth 2 event)))
-! (if (ns-in-echo-area)
-!         (ns-echo-marked-text pos len)
-! (ns-insert-marked-text pos len))))
-!
-! (defun ns-insert-marked-text (pos len)
-! "Insert contents of `ns-working-text' as UTF-8 string and mark with
-! `ns-working-overlay' and `ns-marked-overlay'. Any previously existing
-! working text is cleared first. The overlay is assigned the faces
-! `ns-working-text-face' and `ns-marked-text-face'."
-! (ns-delete-working-text)
-! (let ((start (point)))
-! (if (<= pos (length ns-working-text))
-! (progn
-!         (put-text-property pos len 'face 'ns-working-text-face ns-working-text)
-!         (insert ns-working-text)
-!         (if (= len 0)
-!          (overlay-put (setq ns-working-overlay
-!                          (make-overlay start (point) (current-buffer) nil t))
-!                          'face 'ns-working-text-face)
-!          (overlay-put (setq ns-working-overlay
-!                          (make-overlay start (point) (current-buffer) nil t))
-!                  'face 'ns-unmarked-text-face)
-!          (overlay-put (setq ns-marked-overlay
-!                          (make-overlay (+ start pos) (+ start pos len)
-!                                          (current-buffer) nil t))
-!                  'face 'ns-marked-text-face))
-!         (goto-char (+ start pos))))))
-!
-! (defun ns-echo-marked-text (pos len)
-! "Echo contents of `ns-working-text' in message display area.
-! See `ns-insert-working-text'."
-! (let* ((msg (current-message))
-! (msglen (length msg))
-! message-log-max)
-! (when (integerp ns-working-overlay)
-! (setq msg (substring msg 0 (- (length msg) ns-working-overlay)))
-! (setq msglen (length msg)))
-! (setq ns-working-overlay (length ns-working-text))
-! (setq msg (concat msg ns-working-text))
-! (if (= len 0)
-! (put-text-property msglen (+ msglen ns-working-overlay)
-! 'face 'ns-working-text-face msg)
-! (put-text-property msglen (+ msglen ns-working-overlay)
-! 'face 'ns-unmarked-text-face msg)
-! (put-text-property (+ msglen pos) (+ msglen pos len)
-! 'face 'ns-marked-text-face msg))
- (message "%s" msg)))
-
- (defun ns-delete-working-text()
-! "Delete working text and clear `ns-working-overlay' and `ns-marked-overlay'."
- (interactive)
-+ (when (and (overlayp ns-marked-overlay)
-+          ;; Still alive
-+          (overlay-buffer ns-marked-overlay))
-+ (with-current-buffer (overlay-buffer ns-marked-overlay)
-+ (delete-overlay ns-marked-overlay)))
-+ (setq ns-marked-overlay nil)
- (cond
- ((and (overlayp ns-working-overlay)
- ;; Still alive?
-*************** See the documentation of `create-fontset
-*** 943,948 ****
---- 1025,1490 ----
- (add-to-list 'window-system-initialization-alist '(ns . ns-initialize-window-system))
-
-
-+ ;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;
-+ ;;
-+ ;; Implementation of Input Method Extension for MacOS X
-+ ;; written by Taiichi Hashimoto <taiichi2@mac.com>
-+ ;;
-+
-+ (defvar mac-input-method-parameters
-+ '(
-+ ("com.apple.inputmethod.Kotoeri.Roman"
-+ (title . "A")
-+ (cursor-color)
-+ (cursor-type))
-+ ("com.apple.inputmethod.Kotoeri.Japanese"
-+ (title . "あ")
-+ (cursor-color)
-+ (cursor-type))
-+ ("com.apple.inputmethod.Kotoeri.Japanese.Katakana"
-+ (title . "ア")
-+ (cursor-color)
-+ (cursor-type))
-+ ("com.apple.inputmethod.Kotoeri.Japanese.FullWidthRoman"
-+ (title . "A")
-+ (cursor-color)
-+ (cursor-type))
-+ ("com.apple.inputmethod.Kotoeri.Japanese.HalfWidthKana"
-+ (title . "ア")
-+ (cursor-color)
-+ (cursor-type))
-+ ("com.apple.inputmethod.kotoeri.Ainu"
-+ (title . "アイヌ")
-+ (cursor-color)
-+ (cursor-type))
-+ ("com.apple.inputmethod.Korean.2SetKorean"
-+ (title . "가2")
-+ (cursor-color)
-+ (cursor-type))
-+ ("com.apple.inputmethod.Korean.3SetKorean"
-+ (title . "가3")
-+ (cursor-color)
-+ (cursor-type))
-+ ("com.apple.inputmethod.Korean.390Sebulshik"
-+ (title . "가5")
-+ (cursor-color)
-+ (cursor-type))
-+ ("com.apple.inputmethod.Korean.GongjinCheongRomaja"
-+ (title . "가G")
-+ (cursor-color)
-+ (cursor-type))
-+ ("com.apple.inputmethod.Korean.HNCRomaja"
-+ (title . "가H")
-+ (cursor-color)
-+ (cursor-type))
-+ ("com.apple.inputmethod.Tamil.AnjalIM"
-+ (title . "Anjal")
-+ (cursor-color)
-+ (cursor-type))
-+ ("com.apple.inputmethod.Tamil.Tamil99"
-+ (title . "Tamil")
-+ (cursor-color)
-+ (cursor-type))
-+ ("com.apple.inputmethod.VietnameseIM.VietnameseSimpleTelex"
-+ (title . "ST")
-+ (cursor-color)
-+ (cursor-type))
-+ ("com.apple.inputmethod.VietnameseIM.VietnameseTelex"
-+ (title . "TX")
-+ (cursor-color)
-+ (cursor-type))
-+ ("com.apple.inputmethod.VietnameseIM.VietnameseVNI"
-+ (title . "VN")
-+ (cursor-color)
-+ (cursor-type))
-+ ("com.apple.inputmethod.VietnameseIM.VietnameseVIQR"
-+ (title . "VQ")
-+ (cursor-color)
-+ (cursor-type))
-+ ("com.apple.inputmethod.SCIM.ITABC"
-+ (title . "拼")
-+ (cursor-color)
-+ (cursor-type))
-+ ("com.apple.inputmethod.SCIM.WBX"
-+ (title . "型")
-+ (cursor-color)
-+ (cursor-type))
-+ ("com.apple.inputmethod.SCIM.WBH"
-+ (title . "画")
-+ (cursor-color)
-+ (cursor-type))
-+ ("com.apple.inputmethod.TCIM.Zhuyin"
-+ (title . "注")
-+ (cursor-color)
-+ (cursor-type))
-+ ("com.apple.inputmethod.TCIM.Pinyin"
-+ (title . "拼")
-+ (cursor-color)
-+ (cursor-type))
-+ ("com.apple.inputmethod.TCIM.Cangjie"
-+ (title . "倉")
-+ (cursor-color)
-+ (cursor-type))
-+ ("com.apple.inputmethod.TCIM.Jianyi"
-+ (title . "速")
-+ (cursor-color)
-+ (cursor-type))
-+ ("com.apple.inputmethod.TCIM.Dayi"
-+ (title . "易")
-+ (cursor-color)
-+ (cursor-type))
-+ ("com.apple.inputmethod.TCIM.Hanin"
-+ (title . "漢")
-+ (cursor-color)
-+ (cursor-type))
-+ ("com.google.inputmethod.Japanese.Roman"
-+ (title . "G")
-+ (cursor-color)
-+ (cursor-type))
-+ ("com.google.inputmethod.Japanese.base"
-+ (title . "ぐ")
-+ (cursor-color)
-+ (cursor-type))
-+ ("com.google.inputmethod.Japanese.Katakana"
-+ (title . "グ")
-+ (cursor-color)
-+ (cursor-type))
-+ ("com.google.inputmethod.Japanese.FullWidthRoman"
-+ (title . "G")
-+ (cursor-color)
-+ (cursor-type))
-+ ("com.google.inputmethod.Japanese.HalfWidthKana"
-+ (title . "グ")
-+ (cursor-color)
-+ (cursor-type))
-+ ("jp.monokakido.inputmethod.Kawasemi.Roman"
-+ (title . "K")
-+ (cursor-color)
-+ (cursor-type))
-+ ("jp.monokakido.inputmethod.Kawasemi.Japanese"
-+ (title . "か")
-+ (cursor-color)
-+ (cursor-type))
-+ ("jp.monokakido.inputmethod.Kawasemi.Japanese.Katakana"
-+ (title . "カ")
-+ (cursor-color)
-+ (cursor-type))
-+ ("jp.monokakido.inputmethod.Kawasemi.Japanese.FullWidthRoman"
-+ (title . "K")
-+ (cursor-color)
-+ (cursor-type))
-+ ("jp.monokakido.inputmethod.Kawasemi.Japanese.HalfWidthKana"
-+ (title . "カ")
-+ (cursor-color)
-+ (cursor-type))
-+ ("jp.monokakido.inputmethod.Kawasemi.Japanese.HalfWidthRoman"
-+ (title . "_K")
-+ (cursor-color)
-+ (cursor-type))
-+ ("jp.monokakido.inputmethod.Kawasemi.Japanese.Code"
-+ (title . "C")
-+ (cursor-color)
-+ (cursor-type))
-+ ("com.justsystems.inputmethod.atok21.Roman"
-+ (title . "A")
-+ (cursor-color)
-+ (cursor-type))
-+ ("com.justsystems.inputmethod.atok21.Japanese"
-+ (title . "あ")
-+ (cursor-color)
-+ (cursor-type))
-+ ("com.justsystems.inputmethod.atok21.Japanese.Katakana"
-+ (title . "ア")
-+ (cursor-color)
-+ (cursor-type))
-+ ("com.justsystems.inputmethod.atok21.Japanese.FullWidthRoman"
-+ (title . "英")
-+ (cursor-color)
-+ (cursor-type))
-+ ("com.justsystems.inputmethod.atok21.Japanese.HalfWidthEiji"
-+ (title . "半英")
-+ (cursor-color)
-+ (cursor-type))
-+ ("com.justsystems.inputmethod.atok22.Roman"
-+ (title . "A")
-+ (cursor-color)
-+ (cursor-type))
-+ ("com.justsystems.inputmethod.atok22.Japanese"
-+ (title . "あ")
-+ (cursor-color)
-+ (cursor-type))
-+ ("com.justsystems.inputmethod.atok22.Japanese.Katakana"
-+ (title . "ア")
-+ (cursor-color)
-+ (cursor-type))
-+ ("com.justsystems.inputmethod.atok22.Japanese.FullWidthRoman"
-+ (title . "英")
-+ (cursor-color)
-+ (cursor-type))
-+ ("com.justsystems.inputmethod.atok22.Japanese.HalfWidthEiji"
-+ (title . "半英")
-+ (cursor-color)
-+ (cursor-type))
-+ ("com.justsystems.inputmethod.atok23.Roman"
-+ (title . "A")
-+ (cursor-color)
-+ (cursor-type))
-+ ("com.justsystems.inputmethod.atok23.Japanese"
-+ (title . "あ")
-+ (cursor-color)
-+ (cursor-type))
-+ ("com.justsystems.inputmethod.atok23.Japanese.Katakana"
-+ (title . "ア")
-+ (cursor-color)
-+ (cursor-type))
-+ ("com.justsystems.inputmethod.atok23.Japanese.FullWidthRoman"
-+ (title . "英")
-+ (cursor-color)
-+ (cursor-type))
-+ ("com.justsystems.inputmethod.atok23.Japanese.HalfWidthEiji"
-+ (title . "半英")
-+ (cursor-color)
-+ (cursor-type))
-+ ("com.justsystems.inputmethod.atok24.Roman"
-+ (title . "A")
-+ (cursor-color)
-+ (cursor-type))
-+ ("com.justsystems.inputmethod.atok24.Japanese"
-+ (title . "あ")
-+ (cursor-color)
-+ (cursor-type))
-+ ("com.justsystems.inputmethod.atok24.Japanese.Katakana"
-+ (title . "ア")
-+ (cursor-color)
-+ (cursor-type))
-+ ("com.justsystems.inputmethod.atok24.Japanese.FullWidthRoman"
-+ (title . "英")
-+ (cursor-color)
-+ (cursor-type))
-+ ("com.justsystems.inputmethod.atok24.Japanese.HalfWidthEiji"
-+ (title . "半英")
-+ (cursor-color)
-+ (cursor-type))
-+ ("com.justsystems.inputmethod.atok25.Roman"
-+ (title . "A")
-+ (cursor-color)
-+ (cursor-type))
-+ ("com.justsystems.inputmethod.atok25.Japanese"
-+ (title . "あ")
-+ (cursor-color)
-+ (cursor-type))
-+ ("com.justsystems.inputmethod.atok25.Japanese.Katakana"
-+ (title . "ア")
-+ (cursor-color)
-+ (cursor-type))
-+ ("com.justsystems.inputmethod.atok25.Japanese.FullWidthRoman"
-+ (title . "英")
-+ (cursor-color)
-+ (cursor-type))
-+ ("com.justsystems.inputmethod.atok25.Japanese.HalfWidthEiji"
-+ (title . "半英")
-+ (cursor-color)
-+ (cursor-type))
-+ )
-+ "Alist of Mac script code vs parameters for input method on MacOSX.")
-+
-+
-+ (defun mac-get-input-method-parameter (is key)
-+ "Function to get a parameter of a input method."
-+ (interactive)
-+ (assq key (cdr (assoc is mac-input-method-parameters))))
-+
-+ (defun mac-get-input-method-title (&optional input-source)
-+ "Return input method title of input source.
-+ If input-source is nil, return one of current frame."
-+ (if input-source
-+ (cdr (mac-get-input-method-parameter input-source 'title))
-+ current-input-method-title))
-+
-+ (defun mac-get-cursor-type (&optional input-source)
-+ "Return cursor type of input source.
-+ If input-source is nil, return one of current frame."
-+ (if input-source
-+ (or (cdr (mac-get-input-method-parameter input-source 'cursor-type))
-+          (cdr (assq 'cursor-type default-frame-alist))
-+          cursor-type)
-+ (cdr (assq 'cursor-type (frame-parameters (selected-frame))))))
-+
-+ (defun mac-get-cursor-color (&optional input-source)
-+ "Return cursor color of input source.
-+ If input-source is nil, return one of current frame."
-+ (if input-source
-+ (or (cdr (mac-get-input-method-parameter input-source 'cursor-color))
-+          (cdr (assq 'cursor-color default-frame-alist)))
-+ (cdr (assq 'cursor-color (frame-parameters (selected-frame))))))
-+
-+
-+ (defun mac-set-input-method-parameter (is key value)
-+ "Function to set a parameter of a input method."
-+ (let* ((is-param (assoc is mac-input-method-parameters))
-+ (param (assq key is-param)))
-+ (if is-param
-+         (if param
-+          (setcdr param value)
-+          (setcdr is-param (cons (cons key value) (cdr is-param))))
-+ (setq mac-input-method-parameters
-+          (cons (list is (cons key value))
-+                  mac-input-method-parameters)))))
-+
-+
-+ (defun mac-input-method-update (is)
-+ "Funtion to update parameters of a input method."
-+ (interactive)
-+
-+ (let ((title (mac-get-input-method-title is))
-+ (type (mac-get-cursor-type is))
-+ (color (mac-get-cursor-color is)))
-+ (if (and title (not (equal title (mac-get-input-method-title))))
-+         (setq current-input-method-title title))
-+ (if (and type (not (equal type (mac-get-cursor-type))))
-+         (setq cursor-type type))
-+ (if (and color (not (equal color (mac-get-cursor-color))))
-+         (set-cursor-color color))
-+ (force-mode-line-update)
-+ (if isearch-mode (isearch-update))))
-+
-+
-+ (defun mac-toggle-input-method (&optional arg)
-+ "Function to toggle input method on MacOSX."
-+ (interactive)
-+
-+ (if arg
-+ (progn
-+         (make-local-variable 'input-method-function)
-+         (setq inactivate-current-input-method-function 'mac-toggle-input-method)
-+         (setq input-method-function nil)
-+         (setq describe-current-input-method-function nil)
-+         (mac-toggle-input-source t))
-+ (kill-local-variable 'input-method-function)
-+ (setq describe-current-input-method-function nil)
-+ (mac-toggle-input-source nil)))
-+
-+
-+ (defun mac-change-language-to-us ()
-+ "Function to change language to us."
-+ (interactive)
-+ (mac-toggle-input-method nil))
-+
-+
-+ (defun mac-handle-input-method-change ()
-+ "Function run when a input method change."
-+ (interactive)
-+
-+ (if (equal default-input-method "MacOSX")
-+ (let ((input-source (mac-get-current-input-source))
-+          (ascii-capable (mac-input-source-is-ascii-capable)))
-+         
-+         (cond ((and (not current-input-method) (not ascii-capable))
-+          (set-input-method "MacOSX"))
-+          ((and (equal current-input-method "MacOSX") ascii-capable)
-+          (toggle-input-method nil)))
-+         (mac-input-method-update input-source))))
-+
-+ ;;
-+ ;; Emacs input method for input method on MacOSX.
-+ ;;
-+ (register-input-method "MacOSX" "MacOSX" 'mac-toggle-input-method
-+                  "Mac" "Input Method on MacOSX System")
-+
-+
-+ ;;
-+ ;; Minor mode of using input methods on MacOS X
-+ ;;
-+ (define-minor-mode mac-input-method-mode
-+ "Use input methods on MacOSX."
-+ :init-value nil
-+ :group 'ns
-+ :global t
-+
-+ (if mac-input-method-mode
-+ (progn
-+         (setq default-input-method "MacOSX")
-+         (add-hook 'minibuffer-setup-hook 'mac-change-language-to-us)
-+         (mac-translate-from-yen-to-backslash))
-+ (setq default-input-method nil)))
-+
-+ ;;
-+ ;; Valiable and functions to pass key(shortcut) to system.
-+ ;;
-+ (defvar mac-keys-passed-to-system nil
-+ "A list of keys passed to system on MacOSX.")
-+
-+ (defun mac-add-key-passed-to-system (key)
-+ (let ((shift '(shift shft))
-+         (control '(control ctrl ctl))
-+         (option '(option opt alternate alt))
-+         (command '(command cmd)))
-+
-+ (add-to-list 'mac-keys-passed-to-system
-+                  (cond ((symbolp key)
-+                         (cond ((memq key shift)
-+                          (cons ns-shift-key-mask nil))
-+                          ((memq key control)
-+                          (cons ns-control-key-mask nil))
-+                          ((memq key option)
-+                          (cons ns-alternate-key-mask nil))
-+                          ((memq key command)
-+                          (cons ns-command-key-mask nil))
-+                          (t (cons nil nil))))
-+                  ((numberp key) (cons 0 key))
-+                  ((listp key)
-+                         (let ((l key) (k nil) (m 0))
-+                          (while l
-+                          (cond ((memq (car l) shift)
-+                                  (setq m (logior m ns-shift-key-mask)))
-+                                  ((memq (car l) control)
-+                                  (setq m (logior m ns-control-key-mask)))
-+                                  ((memq (car l) option)
-+                                  (setq m (logior m ns-alternate-key-mask)))
-+                                  ((memq (car l) command)
-+                                  (setq m (logior m ns-command-key-mask)))
-+                                  ((numberp (car l))
-+                                  (if (not k) (setq k (car l)))))
-+                          (setq l (cdr l)))
-+                          (cons m k)))
-+                  (t (cons nil nil))))))
-+
-+
-+ ;;
-+ ;; Entry Emacs event for inline input method on MacOSX.
-+ ;;
-+ (define-key special-event-map
-+ [mac-change-input-method] 'mac-handle-input-method-change)
-+
-+ ;;
-+ ;; Convert yen to backslash for JIS keyboard.
-+ ;;
-+ (defun mac-translate-from-yen-to-backslash ()
-+ ;; Convert yen to backslash for JIS keyboard.
-+ (interactive)
-+
-+ (define-key global-map [165] nil)
-+ (define-key global-map [2213] nil)
-+ (define-key global-map [3420] nil)
-+ (define-key global-map [67109029] nil)
-+ (define-key global-map [67111077] nil)
-+ (define-key global-map [8388773] nil)
-+ (define-key global-map [134219941] nil)
-+ (define-key global-map [75497596] nil)
-+ (define-key global-map [201328805] nil)
-+ (define-key function-key-map [165] [?\\])
-+ (define-key function-key-map [2213] [?\\]) ;; for Intel
-+ (define-key function-key-map [3420] [?\\]) ;; for PowerPC
-+ (define-key function-key-map [67109029] [?\C-\\])
-+ (define-key function-key-map [67111077] [?\C-\\])
-+ (define-key function-key-map [8388773] [?\M-\\])
-+ (define-key function-key-map [134219941] [?\M-\\])
-+ (define-key function-key-map [75497596] [?\C-\M-\\])
-+ (define-key function-key-map [201328805] [?\C-\M-\\])
-+ )
-+
-+ ;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;;
-+
- (provide 'ns-win)
-
- ;;; ns-win.el ends here
-diff -r -N -p ../emacs-24.3.org/src/Makefile.in src/Makefile.in
-*** ../emacs-24.3.org/src/Makefile.in        2013-01-02 05:37:17.000000000 +0900
---- src/Makefile.in        2013-04-13 21:49:53.000000000 +0900
-*************** obj = $(base_obj) $(NS_OBJC_OBJ)
-*** 356,362 ****
- SOME_MACHINE_OBJECTS = dosfns.o msdos.o \
- xterm.o xfns.o xmenu.o xselect.o xrdb.o xsmfns.o fringe.o image.o \
- fontset.o dbusbind.o cygw32.o \
-! nsterm.o nsfns.o nsmenu.o nsselect.o nsimage.o nsfont.o \
- w32.o w32console.o w32fns.o w32heap.o w32inevt.o \
- w32menu.o w32proc.o w32reg.o w32select.o w32term.o w32xfns.o \
- w16select.o widget.o xfont.o ftfont.o xftfont.o ftxfont.o gtkutil.o \
---- 356,362 ----
- SOME_MACHINE_OBJECTS = dosfns.o msdos.o \
- xterm.o xfns.o xmenu.o xselect.o xrdb.o xsmfns.o fringe.o image.o \
- fontset.o dbusbind.o cygw32.o \
-! nsterm.o nsfns.o nsmenu.o nsselect.o nsimage.o nsfont.o macim.o \
- w32.o w32console.o w32fns.o w32heap.o w32inevt.o \
- w32menu.o w32proc.o w32reg.o w32select.o w32term.o w32xfns.o \
- w16select.o widget.o xfont.o ftfont.o xftfont.o ftxfont.o gtkutil.o \
-diff -r -N -p ../emacs-24.3.org/src/keyboard.c src/keyboard.c
-*** ../emacs-24.3.org/src/keyboard.c        2013-02-13 13:25:53.000000000 +0900
---- src/keyboard.c        2013-04-13 21:49:53.000000000 +0900
-*************** kbd_buffer_get_event (KBOARD **kbp,
-*** 3862,3869 ****
- {
- if (event->code == KEY_NS_PUT_WORKING_TEXT)
- obj = Fcons (intern ("ns-put-working-text"), Qnil);
-! else
- obj = Fcons (intern ("ns-unput-working-text"), Qnil);
-          kbd_fetch_ptr = event + 1;
- if (used_mouse_menu)
- *used_mouse_menu = 1;
---- 3862,3871 ----
- {
- if (event->code == KEY_NS_PUT_WORKING_TEXT)
- obj = Fcons (intern ("ns-put-working-text"), Qnil);
-! else if (event->code == KEY_NS_UNPUT_WORKING_TEXT)
- obj = Fcons (intern ("ns-unput-working-text"), Qnil);
-+          else if (event->code == KEY_NS_PUT_MARKED_TEXT)
-+          obj = Fcons (intern ("ns-put-marked-text"), event->arg);
-          kbd_fetch_ptr = event + 1;
- if (used_mouse_menu)
- *used_mouse_menu = 1;
-*************** keys_of_keyboard (void)
-*** 12088,12093 ****
---- 12090,12097 ----
-                          "ns-put-working-text");
- initial_define_lispy_key (Vspecial_event_map, "ns-unput-working-text",
-                          "ns-unput-working-text");
-+ initial_define_lispy_key (Vspecial_event_map, "ns-put-marked-text",
-+                          "ns-put-marked-text");
- /* Here we used to use `ignore-event' which would simple set prefix-arg to
- current-prefix-arg, as is done in `handle-switch-frame'.
- But `handle-switch-frame is not run from the special-map.
-diff -r -N -p ../emacs-24.3.org/src/macim.m src/macim.m
-*** ../emacs-24.3.org/src/macim.m        1970-01-01 09:00:00.000000000 +0900
---- src/macim.m        2013-04-13 21:50:24.000000000 +0900
-***************
-*** 0 ****
---- 1,184 ----
-+ /* Implementation of Input Method Extension for MacOS X.
-+ Copyright (C) 2004, 2005, 2006, 2007, 2008, 2009, 2010, 2011
-+ Taiichi Hashimoto <taiichi2@mac.com>.
-+ */
-+
-+ #include "config.h"
-+
-+ #ifdef NS_IMPL_COCOA
-+
-+ #include <math.h>
-+ #include <sys/types.h>
-+ #include <time.h>
-+ #include <signal.h>
-+ #include <unistd.h>
-+
-+ #include <Carbon/Carbon.h>
-+
-+ #include "lisp.h"
-+ #include "blockinput.h"
-+
-+ enum output_method
-+ {
-+ output_initial,
-+ output_termcap,
-+ output_x_window,
-+ output_msdos_raw,
-+ output_w32,
-+ output_mac,
-+ output_ns
-+ } output_method;
-+
-+ #include "termhooks.h"
-+ #include "keyboard.h"
-+ #include "buffer.h"
-+
-+ //extern Lisp_Object Qcurrent_input_method;
-+ //extern int cursor_in_echo_area;
-+ static Lisp_Object Qmac_keys_passed_to_system;
-+
-+ void mac_init_input_method ();
-+ int mac_pass_key_to_system (int code, int modifiers);
-+ int mac_pass_key_directly_to_emacs ();
-+ int mac_store_change_input_method_event ();
-+
-+ DEFUN ("mac-input-source-is-ascii-capable", Fmac_input_source_is_ascii_capable, Smac_input_source_is_ascii_capable,
-+ 0, 0, 0,
-+ doc: /* Is current input source ascii capable? */)
-+ (void)
-+ {
-+ TISInputSourceRef is = TISCopyCurrentKeyboardInputSource();
-+ CFBooleanRef ret = TISGetInputSourceProperty(is, kTISPropertyInputSourceIsASCIICapable);
-+
-+ return CFBooleanGetValue(ret)? Qt : Qnil;
-+ }
-+
-+ DEFUN ("mac-get-input-source-list", Fmac_get_input_source_list, Smac_get_input_source_list,
-+ 0, 0, 0,
-+ doc: /* get input source list on MacOSX */)
-+ (void)
-+ {
-+ NSArray *is_list = (NSArray *)TISCreateInputSourceList(NULL, false);
-+ int list_size = [is_list count];
-+ Lisp_Object list[list_size];
-+ int i;
-+
-+ for (i = 0; i < list_size; i++) {
-+ TISInputSourceRef is = (TISInputSourceRef)[is_list objectAtIndex:i];
-+ NSString *id = (NSString *)TISGetInputSourceProperty(is, kTISPropertyInputSourceID);
-+ list[i] = make_string([id UTF8String],
-+                          [id lengthOfBytesUsingEncoding:NSUTF8StringEncoding]);
-+ }
-+
-+ return Flist(list_size, list);
-+ }
-+
-+ DEFUN ("mac-get-current-input-source", Fmac_get_current_input_source, Smac_get_current_input_source,
-+ 0, 0, 0,
-+ doc: /* get current input source on MacOSX */)
-+ (void)
-+ {
-+ TISInputSourceRef is = TISCopyCurrentKeyboardInputSource();
-+ NSString *id = (NSString *)TISGetInputSourceProperty(is, kTISPropertyInputSourceID);
-+
-+ return make_string([id UTF8String],
-+                  [id lengthOfBytesUsingEncoding:NSUTF8StringEncoding]);
-+ }
-+
-+ DEFUN ("mac-toggle-input-source", Fmac_toggle_input_source, Smac_toggle_input_source,
-+ 1, 1, 0,
-+ doc: /* toggle input source on MacOSX */)
-+ (arg)
-+ Lisp_Object arg;
-+ {
-+ TISInputSourceRef is = NULL;
-+
-+ if (NILP (arg))
-+ {
-+ is = TISCopyCurrentASCIICapableKeyboardInputSource();
-+ }
-+ else
-+ {
-+ NSString *locale;
-+ NSArray *languages = [NSLocale preferredLanguages];
-+ if (languages != nil) {
-+          locale = [languages objectAtIndex:0];
-+ } else {
-+          locale = [[NSLocale currentLocale]
-+                          objectForKey:NSLocaleLanguageCode];
-+ }
-+ is = TISCopyInputSourceForLanguage((CFStringRef)locale);
-+ }
-+ if (is) TISSelectInputSource(is);
-+
-+ return arg;
-+ }
-+
-+ int
-+ mac_store_change_input_method_event ()
-+ {
-+ Lisp_Object dim;
-+ int ret = FALSE;
-+
-+ dim = Fsymbol_value (intern ("default-input-method"));
-+ if (STRINGP (dim) && strcmp(SDATA (dim), "MacOSX") == 0)
-+ {
-+ ret = TRUE;
-+ }
-+
-+ return ret;
-+ }
-+
-+ int
-+ mac_pass_key_to_system (int code, int modifiers)
-+ {
-+ Lisp_Object keys = Fsymbol_value (Qmac_keys_passed_to_system);
-+ Lisp_Object m, k;
-+
-+ while (!NILP (keys))
-+ {
-+ m = XCAR (XCAR (keys));
-+ k = XCDR (XCAR (keys));
-+ keys = XCDR (keys);
-+
-+ if (NUMBERP (m) && modifiers == XINT (m))
-+         if (NILP (k)
-+          || (NUMBERP (k) && code == XINT (k)))
-+          return TRUE;
-+ }
-+
-+ return FALSE;
-+ }
-+
-+ int
-+ mac_pass_key_directly_to_emacs (void)
-+ {
-+
-+ if (NILP (Fmac_input_source_is_ascii_capable()))
-+ {
-+ if (NILP (Vmac_use_input_method_on_system)
-+          || this_command_key_count
-+          || cursor_in_echo_area
-+          || !NILP (BVAR (current_buffer, read_only)))
-+         return TRUE;
-+ }
-+
-+ return FALSE;
-+ }
-+
-+
-+ void mac_init_input_method (void)
-+ {
-+ Qmac_keys_passed_to_system = intern ("mac-keys-passed-to-system");
-+ staticpro (&Qmac_keys_passed_to_system);
-+
-+ DEFVAR_LISP ("mac-use-input-method-on-system", Vmac_use_input_method_on_system,
-+ doc: /* If it is non-nil, use input method on system. */);
-+ Vmac_use_input_method_on_system = Qt;
-+
-+ defsubr (&Smac_input_source_is_ascii_capable);
-+ defsubr (&Smac_get_input_source_list);
-+ defsubr (&Smac_get_current_input_source);
-+ defsubr (&Smac_toggle_input_source);
-+ }
-+ #endif
-diff -r -N -p ../emacs-24.3.org/src/nsfns.m src/nsfns.m
-*** ../emacs-24.3.org/src/nsfns.m        2013-01-02 05:37:17.000000000 +0900
---- src/nsfns.m        2013-04-13 21:49:53.000000000 +0900
-*************** static ptrdiff_t image_cache_refcount;
-*** 107,113 ****
-
- ========================================================================== */
-
--
- void
- check_ns (void)
- {
---- 107,112 ----
-*************** be used as the image of the icon represe
-*** 2702,2707 ****
---- 2701,2724 ----
- doc: /* Toolkit version for NS Windowing. */);
- Vns_version_string = ns_appkit_version_str ();
-
-+
-+ DEFVAR_LISP ("ns-shift-key-mask", Vns_shift_key_mask,
-+ doc: /* Shift key mask defined in system. */);
-+ Vns_shift_key_mask = make_number (NSShiftKeyMask);
-+
-+ DEFVAR_LISP ("ns-control-key-mask", Vns_control_key_mask,
-+ doc: /* Control key mask defined in system. */);
-+ Vns_control_key_mask = make_number (NSControlKeyMask);
-+
-+ DEFVAR_LISP ("ns-alternate-key-mask", Vns_alternate_key_mask,
-+ doc: /* Alternate key mask defined in system. */);
-+ Vns_alternate_key_mask = make_number (NSAlternateKeyMask);
-+
-+ DEFVAR_LISP ("ns-command-key-mask", Vns_command_key_mask,
-+ doc: /* Command key mask defined in system. */);
-+ Vns_command_key_mask = make_number (NSCommandKeyMask);
-+
-+
- defsubr (&Sns_read_file_name);
- defsubr (&Sns_get_resource);
- defsubr (&Sns_set_resource);
-*************** be used as the image of the icon represe
-*** 2746,2751 ****
---- 2763,2772 ----
- defsubr (&Sx_show_tip);
- defsubr (&Sx_hide_tip);
-
-+ #ifdef NS_IMPL_COCOA
-+ mac_init_input_method ();
-+ #endif
-+
- /* used only in fontset.c */
- check_window_system_func = check_ns;
-
-diff -r -N -p ../emacs-24.3.org/src/nsterm.h src/nsterm.h
-*** ../emacs-24.3.org/src/nsterm.h        2013-01-02 05:37:17.000000000 +0900
---- src/nsterm.h        2013-04-13 21:49:53.000000000 +0900
-*************** typedef unsigned int NSUInteger;
-*** 420,425 ****
---- 420,427 ----
- #define KEY_NS_NEW_FRAME ((1<<28)|(0<<16)|12)
- #define KEY_NS_TOGGLE_TOOLBAR ((1<<28)|(0<<16)|13)
- #define KEY_NS_SHOW_PREFS ((1<<28)|(0<<16)|14)
-+ #define KEY_MAC_CHANGE_INPUT_METHOD ((1<<28)|(0<<16)|15)
-+ #define KEY_NS_PUT_MARKED_TEXT ((1<<28)|(0<<16)|16)
-
- /* could use list to store these, but rest of emacs has a big infrastructure
- for managing a table of bitmap "records" */
-diff -r -N -p ../emacs-24.3.org/src/nsterm.m src/nsterm.m
-*** ../emacs-24.3.org/src/nsterm.m        2013-01-04 18:38:13.000000000 +0900
---- src/nsterm.m        2013-04-13 21:53:51.000000000 +0900
-*************** ns_term_init (Lisp_Object display_name)
-*** 4049,4054 ****
---- 4049,4057 ----
- /* [[NSNotificationCenter defaultCenter] addObserver: NSApp
- selector: @selector (logNotification:)
- name: nil object: nil]; */
-+ [[NSDistributedNotificationCenter defaultCenter] addObserver: NSApp
-+                                         selector: @selector (changeInputMethod:)
-+                                                  name: @"AppleSelectedInputSourcesChangedNotification" object: nil];
-
- dpyinfo = xzalloc (sizeof *dpyinfo);
-
-*************** ns_term_shutdown (int sig)
-*** 4278,4283 ****
---- 4281,4301 ----
- NSLog (@"notification: '%@'", [notification name]);
- }
-
-+ - (void)changeInputMethod: (NSNotification *)notification
-+ {
-+
-+ struct frame *emacsframe = SELECTED_FRAME ();
-+
-+ if (mac_store_change_input_method_event())
-+ {
-+ if (!emacs_event)
-+         return;
-+ emacs_event->kind = NS_NONKEY_EVENT;
-+ emacs_event->code = KEY_MAC_CHANGE_INPUT_METHOD;
-+ emacs_event->modifiers = 0;
-+ EV_TRAILER ((id)nil);
-+ }
-+ }
-
- - (void)sendEvent: (NSEvent *)theEvent
- /* --------------------------------------------------------------------------
-*************** not_in_argv (NSString *arg)
-*** 4957,4963 ****
- code, fnKeysym, flags, emacs_event->modifiers);
-
- /* if it was a function key or had modifiers, pass it directly to emacs */
-! if (fnKeysym || (emacs_event->modifiers
- && (emacs_event->modifiers != shift_modifier)
- && [[theEvent charactersIgnoringModifiers] length] > 0))
- /*[[theEvent characters] length] */
---- 4975,4982 ----
- code, fnKeysym, flags, emacs_event->modifiers);
-
- /* if it was a function key or had modifiers, pass it directly to emacs */
-! if (mac_pass_key_directly_to_emacs ()
-!          ||fnKeysym || (emacs_event->modifiers
- && (emacs_event->modifiers != shift_modifier)
- && [[theEvent charactersIgnoringModifiers] length] > 0))
- /*[[theEvent characters] length] */
-*************** not_in_argv (NSString *arg)
-*** 4972,4979 ****
- ? MULTIBYTE_CHAR_KEYSTROKE_EVENT : ASCII_KEYSTROKE_EVENT;
-
- emacs_event->code = code;
-! EV_TRAILER (theEvent);
-! return;
- }
- }
-
---- 4991,5008 ----
- ? MULTIBYTE_CHAR_KEYSTROKE_EVENT : ASCII_KEYSTROKE_EVENT;
-
- emacs_event->code = code;
-!          /* The function mac_pass_key_to_system decides
-!          whether it is passed directly to emacs or not. */
-!          if (emacs_event->kind == NON_ASCII_KEYSTROKE_EVENT
-!          || !mac_pass_key_to_system (code, flags
-!                                          & (NSShiftKeyMask
-!                                          | NSControlKeyMask
-!                                          | NSAlternateKeyMask
-!                                          | NSCommandKeyMask)))
-!          {
-!          EV_TRAILER (theEvent);
-!          return;
-!          }
- }
- }
-
-*************** not_in_argv (NSString *arg)
-*** 5067,5076 ****
- NSLog (@"setMarkedText '%@' len =%d range %d from %d", str, [str length],
- selRange.length, selRange.location);
-
-- if (workingText != nil)
-- [self deleteWorkingText];
- if ([str length] == 0)
-! return;
-
- if (!emacs_event)
- return;
---- 5096,5114 ----
- NSLog (@"setMarkedText '%@' len =%d range %d from %d", str, [str length],
- selRange.length, selRange.location);
-
- if ([str length] == 0)
-! {
-! [self deleteWorkingText];
-! return;
-! }
-! else
-! {
-! if (workingText != nil) {
-!         [workingText release];
-!         workingText = nil;
-!         processingCompose = NO;
-! }
-! }
-
- if (!emacs_event)
- return;
-*************** not_in_argv (NSString *arg)
-*** 5080,5086 ****
- ns_working_text = build_string ([workingText UTF8String]);
-
- emacs_event->kind = NS_TEXT_EVENT;
-! emacs_event->code = KEY_NS_PUT_WORKING_TEXT;
- EV_TRAILER ((id)nil);
- }
-
---- 5118,5126 ----
- ns_working_text = build_string ([workingText UTF8String]);
-
- emacs_event->kind = NS_TEXT_EVENT;
-! emacs_event->code = KEY_NS_PUT_MARKED_TEXT;
-! emacs_event->arg = Fcons (make_number (selRange.location),
-!                          Fcons (make_number (selRange.length), Qnil));
- EV_TRAILER ((id)nil);
- }
-
-*************** not_in_argv (NSString *arg)
-*** 5135,5149 ****
- {
- NSRect rect;
- NSPoint pt;
-! struct window *win = XWINDOW (FRAME_SELECTED_WINDOW (emacsframe));
- if (NS_KEYLOG)
- NSLog (@"firstRectForCharRange request");
-
- rect.size.width = theRange.length * FRAME_COLUMN_WIDTH (emacsframe);
- rect.size.height = FRAME_LINE_HEIGHT (emacsframe);
- pt.x = WINDOW_TEXT_TO_FRAME_PIXEL_X (win, win->phys_cursor.x);
- pt.y = WINDOW_TO_FRAME_PIXEL_Y (win, win->phys_cursor.y
-! +FRAME_LINE_HEIGHT (emacsframe));
-
- pt = [self convertPoint: pt toView: nil];
- pt = [[self window] convertBaseToScreen: pt];
---- 5175,5197 ----
- {
- NSRect rect;
- NSPoint pt;
-! // struct window *win = XWINDOW (FRAME_SELECTED_WINDOW (emacsframe));
-! struct window *win;
- if (NS_KEYLOG)
- NSLog (@"firstRectForCharRange request");
-+
-+ if (NILP (Vmac_in_echo_area))
-+ win = XWINDOW (FRAME_SELECTED_WINDOW (emacsframe));
-+ else if (WINDOWP (echo_area_window))
-+ win = XWINDOW (echo_area_window);
-+ else
-+ win = XWINDOW (FRAME_SELECTED_WINDOW (emacsframe));
-
- rect.size.width = theRange.length * FRAME_COLUMN_WIDTH (emacsframe);
- rect.size.height = FRAME_LINE_HEIGHT (emacsframe);
- pt.x = WINDOW_TEXT_TO_FRAME_PIXEL_X (win, win->phys_cursor.x);
- pt.y = WINDOW_TO_FRAME_PIXEL_Y (win, win->phys_cursor.y
-! +FRAME_LINE_HEIGHT (emacsframe)+2);
-
- pt = [self convertPoint: pt toView: nil];
- pt = [[self window] convertBaseToScreen: pt];
-*************** variable `x-use-underline-position-prope
-*** 7173,7178 ****
---- 7221,7230 ----
- baseline level. The default value is nil. */);
- x_underline_at_descent_line = 0;
-
-+ DEFVAR_LISP ("mac-in-echo-area", Vmac_in_echo_area,
-+ doc: /* state of cursor in echo area. */);
-+ Vmac_in_echo_area = Qnil;
-+
- /* Tell emacs about this window system. */
- Fprovide (intern ("ns"), Qnil);
- }
-*** ../emacs-24.3.org/configure        2013-03-08 17:13:36.000000000 +0900
---- configure        2013-04-13 23:11:56.000000000 +0900
-*************** if test "${HAVE_NS}" = yes; then
-*** 9650,9656 ****
- leimdir="\${ns_appresdir}/leim"
- INSTALL_ARCH_INDEP_EXTRA=
- fi
-! NS_OBJC_OBJ="nsterm.o nsfns.o nsmenu.o nsselect.o nsimage.o nsfont.o"
- fi
- CFLAGS="$tmp_CFLAGS"
- CPPFLAGS="$tmp_CPPFLAGS"
---- 9650,9656 ----
- leimdir="\${ns_appresdir}/leim"
- INSTALL_ARCH_INDEP_EXTRA=
- fi
-! NS_OBJC_OBJ="nsterm.o nsfns.o nsmenu.o nsselect.o nsimage.o nsfont.o macim.o"
- fi
- CFLAGS="$tmp_CFLAGS"
- CPPFLAGS="$tmp_CPPFLAGS"
-*************** case "$opsys" in
-*** 24618,24624 ****
- ## 0x690 is the total size of 30 segment load commands (at 56
- ## each); under Cocoa 31 commands are required.
- if test "$HAVE_NS" = "yes"; then
-! libs_nsgui="-framework AppKit"
- headerpad_extra=6C8
- else
- libs_nsgui=
---- 24618,24624 ----
- ## 0x690 is the total size of 30 segment load commands (at 56
- ## each); under Cocoa 31 commands are required.
- if test "$HAVE_NS" = "yes"; then
-! libs_nsgui="-framework AppKit -framework Carbon -framework Cocoa"
- headerpad_extra=6C8
- else
- libs_nsgui=
-*** ../emacs-24.3.org/configure.ac        2013-03-05 17:24:59.000000000 +0900
---- configure.ac        2013-04-13 23:11:56.000000000 +0900
-*************** if test "${HAVE_NS}" = yes; then
-*** 1571,1577 ****
- leimdir="\${ns_appresdir}/leim"
- INSTALL_ARCH_INDEP_EXTRA=
- fi
-! NS_OBJC_OBJ="nsterm.o nsfns.o nsmenu.o nsselect.o nsimage.o nsfont.o"
- fi
- CFLAGS="$tmp_CFLAGS"
- CPPFLAGS="$tmp_CPPFLAGS"
---- 1571,1577 ----
- leimdir="\${ns_appresdir}/leim"
- INSTALL_ARCH_INDEP_EXTRA=
- fi
-! NS_OBJC_OBJ="nsterm.o nsfns.o nsmenu.o nsselect.o nsimage.o nsfont.o macim.o"
- fi
- CFLAGS="$tmp_CFLAGS"
- CPPFLAGS="$tmp_CPPFLAGS"
-*************** case "$opsys" in
-*** 4322,4328 ****
- ## 0x690 is the total size of 30 segment load commands (at 56
- ## each); under Cocoa 31 commands are required.
- if test "$HAVE_NS" = "yes"; then
-! libs_nsgui="-framework AppKit"
- headerpad_extra=6C8
- else
- libs_nsgui=
---- 4322,4328 ----
- ## 0x690 is the total size of 30 segment load commands (at 56
- ## each); under Cocoa 31 commands are required.
- if test "$HAVE_NS" = "yes"; then
-! libs_nsgui="-framework AppKit -framework Carbon -framework Cocoa"
- headerpad_extra=6C8
- else
- libs_nsgui=
</del></span></pre></div>
<a id="trunkdportsaquaemacsappfilespatchmaverickshomediff"></a>
<div class="delfile"><h4>Deleted: trunk/dports/aqua/emacs-app/files/patch-mavericks-home.diff (127177 => 127178)</h4>
<pre class="diff"><span>
<span class="info">--- trunk/dports/aqua/emacs-app/files/patch-mavericks-home.diff        2014-10-22 10:34:11 UTC (rev 127177)
+++ trunk/dports/aqua/emacs-app/files/patch-mavericks-home.diff        2014-10-22 10:36:55 UTC (rev 127178)
</span><span class="lines">@@ -1,19 +0,0 @@
</span><del>---- src/emacs.c.orig        2011-01-09 02:45:14.000000000 +0900
-+++ src/emacs.c        2011-09-09 23:13:44.000000000 +0900
-@@ -1156,10 +1156,13 @@
- if (!noninteractive)
- {
- #ifdef NS_IMPL_COCOA
-- if (skip_args < argc)
-+ /* Started from GUI? */
-+ /* FIXME: Do the right thing if getenv returns NULL, or if
-+ chdir fails. */
-+ if (! inhibit_window_system && ! isatty (0))
-+ chdir (getenv ("HOME"));
-+ if (skip_args < argc)
- {
--         /* FIXME: Do the right thing if getenv returns NULL, or if
--         chdir fails. */
- if (!strncmp (argv[skip_args], "-psn", 4))
- {
- skip_args += 1;
</del></span></pre></div>
<a id="trunkdportsaquaemacsappfilespatchmavericksmemleakdiff"></a>
<div class="delfile"><h4>Deleted: trunk/dports/aqua/emacs-app/files/patch-mavericks-memleak.diff (127177 => 127178)</h4>
<pre class="diff"><span>
<span class="info">--- trunk/dports/aqua/emacs-app/files/patch-mavericks-memleak.diff        2014-10-22 10:34:11 UTC (rev 127177)
+++ trunk/dports/aqua/emacs-app/files/patch-mavericks-memleak.diff        2014-10-22 10:36:55 UTC (rev 127178)
</span><span class="lines">@@ -1,85 +0,0 @@
</span><del>---- src/nsterm.h
-+++ src/nsterm.h
-@@ -55,6 +55,10 @@ along with GNU Emacs. If not, see <http://www.gnu.org/licenses/>. */
- /* We override sendEvent: as a means to stop/start the event loop */
- @interface EmacsApp : NSApplication
- {
-+#if MAC_OS_X_VERSION_MAX_ALLOWED >= MAC_OS_X_VERSION_10_9
-+ BOOL shouldKeepRunning;
-+ BOOL isFirst;
-+#endif
- }
- - (void)logNotification: (NSNotification *)notification;
- - (void)sendEvent: (NSEvent *)theEvent;
-diff --git a/src/nsterm.m b/src/nsterm.m
-index a57e744..324f065 100644
---- src/nsterm.m
-+++ src/nsterm.m
-@@ -3373,7 +3373,7 @@ ns_read_socket (struct terminal *terminal, struct input_event *hold_quit)
- if ([NSApp modalWindow] != nil)
- return -1;
-
-- if (hold_event_q.nr > 0)
-+ if (hold_event_q.nr > 0)
- {
- int i;
- for (i = 0; i < hold_event_q.nr; ++i)
-@@ -3447,7 +3447,7 @@ ns_select (int nfds, fd_set *readfds, fd_set *writefds,
-
- /* NSTRACE (ns_select); */
-
-- if (hold_event_q.nr > 0)
-+ if (hold_event_q.nr > 0)
- {
- /* We already have events pending. */
- kill (0, SIGIO);
-@@ -4270,6 +4270,49 @@ ns_term_shutdown (int sig)
-
- @implementation EmacsApp
-
-+#if MAC_OS_X_VERSION_MAX_ALLOWED >= MAC_OS_X_VERSION_10_9
-+- (id)init
-+{
-+ if (self = [super init])
-+ self->isFirst = YES;
-+
-+ return self;
-+}
-+
-+- (void)run
-+{
-+ NSAutoreleasePool *pool = [[NSAutoreleasePool alloc] init];
-+
-+ if (isFirst) [self finishLaunching];
-+ isFirst = NO;
-+
-+ shouldKeepRunning = YES;
-+ do
-+ {
-+ [pool release];
-+ pool = [[NSAutoreleasePool alloc] init];
-+
-+ NSEvent *event =
-+ [self nextEventMatchingMask:NSAnyEventMask
-+ untilDate:[NSDate distantFuture]
-+ inMode:NSDefaultRunLoopMode
-+ dequeue:YES];
-+ [self sendEvent:event];
-+ [self updateWindows];
-+ } while (shouldKeepRunning);
-+
-+ [pool release];
-+}
-+
-+- (void)stop: (id)sender
-+{
-+ shouldKeepRunning = NO;
-+ // Stop possible dialog also. Noop if no dialog present.
-+ // The file dialog still leaks 7k - 10k on 10.9 though.
-+ [super stop:sender];
-+}
-+#endif
-+
- - (void)logNotification: (NSNotification *)notification
- {
- const char *name = [[notification name] UTF8String];
</del></span></pre>
</div>
</div>
</body>
</html>